SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041232 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041232
Domain Number 1 Region: 3-183
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-38
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 192-310
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000201
Family Fibronectin type III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041232   Gene: ENSMODG00000027921   Transcript: ENSMODT00000044341
Sequence length 552
Comment pep:novel chromosome:BROADO5:Un:74022079:74031428:1 gene:ENSMODG00000027921 transcript:ENSMODT00000044341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVSATAMNTALIQWHPPKDVPGELLGYRLQFRRTDEERPTTVAFGPEDHHFTVTGLHKG
ATYVFRLSAKNRAGPGEASEKEVATPEDAPSGFPQNLQVVGLTTSTTELQWDPPVLAERN
GRITNYTVLYRDINSQHELQAFTGGTRLALGGLLPDTTYDIKVRAHTARGPGPLSPSIQS
RTMPVEQVFAKNFRVSAVMKTSVLLSWEVPDSYKSSVPFKILYNGQSVEVDGHSMKKLIR
DLQPNTEYSFVLMSRGSSAGGLQHLVSIRTAPELLLQKPLPLAKYMEDGRFTLTLPRVET
KSAIRWFYIVVVPIDRLAGGPLGPRWQTPDELQLDQLLEAIGQGGAAARRRRQVERLKPY
VAAQVDELPETFTLGDKKHYNGFYNRPLSPDLSYHCFVLAALEAGDTRQYAASPYSDEIL
VEVSSAKQQDEPEMLWVMGPVLAVILIILIVIAILLFKRKRTNSPSAKDEQSVGLKDSLL
AHSSDPVEMRRLNYQTPGMRDHPPIPITDLADNIEQAQGQRRPQVLPGVXXXXXXXXXXX
XXXXXXXXXXXX
Download sequence
Identical sequences K7E630
ENSMODP00000041232 ENSMODP00000041232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]