SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041273 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041273
Domain Number 1 Region: 88-168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000208
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 7-94
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000554
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041273   Gene: ENSMODG00000028737   Transcript: ENSMODT00000044382
Sequence length 175
Comment pep:novel chromosome:BROADO5:Un:63926163:63939632:1 gene:ENSMODG00000028737 transcript:ENSMODT00000044382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSKPTIITSNNTAVETKDFSMTCNATGQIHAYRWFINGLAPGGNRIQLSPDKRTLTIRS
LRRTENKGPYECEIENPLFRKRSNPFTLNVTYGPDNATIVHSANEYPTGANITLSCVADS
NPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTHTATKNIIIY
Download sequence
Identical sequences F7AX48
ENSMODP00000041273 ENSMODP00000041273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]