SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041278 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041278
Domain Number 1 Region: 30-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000803
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000041278
Domain Number - Region: 151-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.023
Family C1 set domains (antibody constant domain-like) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041278   Gene: ENSMODG00000028303   Transcript: ENSMODT00000044387
Sequence length 265
Comment pep:novel chromosome:BROADO5:2:165154459:165189395:1 gene:ENSMODG00000028303 transcript:ENSMODT00000044387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQLLKWLTVILYLHIGEAVSKENEVPLMVIGTVGKSVILPLRITSDKKIRNIVWLSSNS
IATVQINGQNITFIVTDPQYDHRLEIVKSNYSLQINNLKIKDENYYKGQITFENSFPSEP
LIQNYKLHVYEELSKPQVIVNDTLSKNGTCNISLLCHMKKEEKNVTYNWISLKGVEEEIL
QEGPILTVSWRSGESEPNLICRVKNPVSNHSVRANLSMELCTDPQGTSAWIIGIGLIILV
LLSIAFFIIVAVFIWKKKGEGKISL
Download sequence
Identical sequences K7E676
ENSMODP00000041278 ENSMODP00000041278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]