SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041290 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041290
Domain Number 1 Region: 236-364
Classification Level Classification E-value
Superfamily SEA domain 2.22e-33
Family SEA domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041290   Gene: ENSMODG00000027573   Transcript: ENSMODT00000044399
Sequence length 402
Comment pep:novel chromosome:BROADO5:Un:20108321:20131840:-1 gene:ENSMODG00000027573 transcript:ENSMODT00000044399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPLTPVSTVIPTGPSRASEGRMMTTAGESQTIIITISSPAVRTHSVLATTAAPTTACA
IDLEKITVPASSALPELMVAPFAWSGVATSPSETMLIAEICTPLGAGTGGGSPIGVPSHL
TSLDTTTSTTVFPCTNVPPAQSTMCSTISLQSATTLCRVSREERKPKTSLDTSASETTAM
ATARVWLALTKTPTTMDISRGAEAVVLSTSDLPTSSAVPLIPTDKVSTQTTMTTIAHTAA
GSSYSKTFTLNFTITNMFYTPDMGERGSNTFKAAENVLQVLLKFLFGMSNLGSHYSACSV
NLLRSLKNGTATGVDVLCTFQEDSSNPVLNKEKVYWELTEQIQRRRLKHVLIERDSLFVD
GYHHKQPGIISTKSEFSIALFSVVLGDNIRKDIFHPFRWEQC
Download sequence
Identical sequences K7E688
ENSMODP00000041290 ENSMODP00000041290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]