SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041322 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041322
Domain Number 1 Region: 33-129
Classification Level Classification E-value
Superfamily Fibronectin type III 1.98e-26
Family Fibronectin type III 0.00032
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000394
Family Fibronectin type III 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041322   Gene: ENSMODG00000022952   Transcript: ENSMODT00000044431
Sequence length 930
Comment pep:novel chromosome:BROADO5:6:160608962:160672997:-1 gene:ENSMODG00000022952 transcript:ENSMODT00000044431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQPLPAPVCAWWWCLFLWWARCPTWAEFLNSSVNCYSDYDSFFGCEWKTNRPTNCSSEF
QLYYNQTNSHLSGNCTAENKRANEVTLPLECVCQNKVSDFAIADMYQLKIQTGKQVLWEK
HDFIPFQSVKPRTPTDLVISEAPNDALILTWNSTYSSENTYMNNYFIYEVEIFEKDHMPP
VKKWEVFKKPNLTIFAYQLKNKCFHTARVKSKVFDSYTGPWSDWSQTIKWYNEYPEKSLG
PLELGVPIFCILILFVNILCYFSVIKIKKVWWDQIPNPAHSHLTAIIIQDSQLSSWRKLH
KAKEKKSFPHWKICLSKVFPCLLSHNLTGKEESPHSAKDSHFPLPSKREGWPVEVYRAVL
MPEQISVVQSMELYEPEVESEKGDDDDDISFIPSPENSASSFIQNKEALAARFAQTLFFD
LIGEETFMSCSNQPSEKYKDLANATESPLKESKDLSQSWANPTGPGSPIFQNGFPSDPHI
SETVCQSPCQDATSSKIRQPPEPHQEQQQFPSATQMQSTGLALVLEVPQIVADNTGYRSF
NSLLAQSMPRTEEELSPPLGLSNWSSEEMAPCCEEPDLQHEMNCSEDSKTSPAHDGEPSS
LLQPEEESWEEILRQRVLRQEGAVTCPTILATSGYQCFDNAVKQGNDQNYEAASFNVPKE
SGYRSFASLLNDTREKTSAETFGDKSESGKGEGGYQPLENLNSSSQETEKGTLLPLFTFG
MDLGEEALPQKCQHGPMPSNLLKMYSPNNTSEEEIEKCPLTSDREGTTKHKDTPEGSPSC
AKLDFNNSIVYSTLTCHLCGHLKRCQSSGGNYMPLGDAQRTECNCVVENLVILPQPLLKA
NSSFPLEQMESLESGVPRTSSVEPLGESHSKEESSLGVCVSLLSQDWEDPCGSNPEKCKG
ITHLKPNPSQSFSPSMADCEHEGNTYMKIS
Download sequence
Identical sequences K7E6C0
ENSMODP00000041322 ENSMODP00000041322 XP_007499548.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]