SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041340 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041340
Domain Number 1 Region: 57-139
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000178
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 4-46
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000108
Family I set domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041340   Gene: ENSMODG00000028021   Transcript: ENSMODT00000044448
Sequence length 140
Comment pep:novel chromosome:BROADO5:Un:83531662:83533888:1 gene:ENSMODG00000028021 transcript:ENSMODT00000044448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSDLGEATLKIIGVTTEDDGIYTCIAVNDMGSVSSSVSLRVLGPGSDGIMVIWKDNFD
SLYSEVAELGRGRFSVVKKCDQKGAKRSVATKFVNKKLMKRDQVTHELGVMQNLQHPLLI
GLLDTFETSTSYVLVLEMCV
Download sequence
Identical sequences K7E6D8
ENSMODP00000041340 ENSMODP00000041340 XP_007505681.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]