SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000454 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000454
Domain Number 1 Region: 11-147
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.44e-28
Family Hormone receptor domain 0.00025
Further Details:      
 
Domain Number 2 Region: 138-410
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000449
Family Rhodopsin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000454   Gene: ENSMODG00000000380   Transcript: ENSMODT00000000464
Sequence length 451
Comment pep:novel chromosome:BROADO5:4:121512700:121601009:1 gene:ENSMODG00000000380 transcript:ENSMODT00000000464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTMQTSNLWLIIFSWAALTVGAPPLLCDVLQMLQKEEEQCLQELSKEWKNNSENEQPI
SGCPGVWDNMSCWPSASAGQTVKAECPKFLQMLTGKNGSVFRNCTQDGWSDTFPRTDAAC
GYDVNDTTNEKRRSYLLKLKVMYTVGYSTSLVMLLVALGILIAFRKLHCTRNYIHMHLFV
SFILRALSNFIKDAVLFSNDVAHCDDHMVGCKTVMVFFQYCIMSNYSWLLVEGLYLHTLL
VISFFSEKKVLQCFIIFGWGSPAVFATTWAITRHFLENNGCWDINVNPGIWWIIRGPTLI
SVLVNFILFVNILRILMKKLRTSKMRGNDMNHYKRLAKSTLLLIPLFGVHYIIFAFTPED
AGSPTVEIQMFFELALGSFQGLVVAILYCFLNGEVQLEIQRKWRQRYLNNWFWMRPALSS
SFSNGASGPTQMTKASPLEQGRGTAWKASVI
Download sequence
Identical sequences F6R8T5
XP_007494123.1.35504 ENSMODP00000000454 ENSMODP00000000454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]