SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003091 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003091
Domain Number 1 Region: 305-546
Classification Level Classification E-value
Superfamily Kelch motif 7.45e-43
Family Kelch motif 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003091   Gene: ENSMODG00000002543   Transcript: ENSMODT00000003157
Sequence length 591
Comment pep:novel chromosome:BROADO5:4:372532811:372534586:-1 gene:ENSMODG00000002543 transcript:ENSMODT00000003157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSWVFSQAAGVSQERRGLLRATSDLGLAVSQRAGEAGTSYVFSSQARAQVEENWLGEQ
TPGERARGQREASAGPGLRGKIYDYYVESTSRSISSPSGGPGGAVVPQGSPQLPTFGRLP
SQPPADFPDADCLTSPGRTHPAGAAEAVSESSSSSGNPFPPPGPGISRKESFLQIAENPE
FQLPLDPAGASSSGALPLARRASTRSLDPNAAGAGLEPKVESVAGTNFFQLPLLPGAAQN
TRLDLGNCSEVLRLAKREKLDALKEAAYQVMSDNYLQVLQSANIYGHLSGAERELVLRRR
LQGQKYLVVADVCPQEGTGRLCAYDQERDAWWPLASLPPEAISWGCSLCSLFNYLFVVAG
CPRAGGQASNRMFCYNPLTGIWREMCPLNQARPHCKLVVLDGYMYAIGGECLYTVERYDP
RQDRWAFVAALPNDTFALAHTATVCDGEIYVTGGTLRYLLLRYSGQEDRWRASPTGGGKD
RTAEMVAVNGFLYRFDLNRSLGIGVYRCSARTRLWYECATYRVPYPAAFQCAVVDNLIHC
VGRQFHLRFLADYVSPRFLSGDELQRFPSPQGTLIPTVLALPALNMAQTRV
Download sequence
Identical sequences F7ALX5
ENSMODP00000003091 13616.ENSMODP00000003091 ENSMODP00000003091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]