SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003556 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003556
Domain Number 1 Region: 19-48,93-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.22e-21
Family Voltage-gated potassium channels 0.0052
Further Details:      
 
Domain Number 2 Region: 196-301
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-18
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003556   Gene: ENSMODG00000002918   Transcript: ENSMODT00000003633
Sequence length 409
Comment pep:novel chromosome:BROADO5:1:225573807:225805715:-1 gene:ENSMODG00000002918 transcript:ENSMODT00000003633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCQGCCCCWSAGHLNQDNARFLLLAALIVLYMVCGAAVFSAIERAQECRAKEQWEEKLL
NFSLNHNLSLDEIRGFLREYEEATAAGIRIGDSRPRWDFTGAFYFVGTVVSTIGFGMTTP
ATVGGKVFLIFYGLIGCAGTILFFNLFLERLITVIAYIMKSCHERQLRKKGILQSDNQRS
SGTSEADSMVGWKPSVYYVMLILCMASLIISCCASAMYTPIEGWSYFDSLYFCFVAFSTI
GFGDLVSSQNAQYESQGLYRFGNFIFILMGVCCIYSLFNVISILIKQSVNWILKKMECQC
CQCQRKALLLRRNVVTPSNVRSGQEISIETDGVIESETDGRRLSGEMISMKDFLASNKVS
LAILQKQLSETANGCPRQASMSARHKGFSGGVGALAIMNNRLAETSGDR
Download sequence
Identical sequences F6PMU1
ENSMODP00000003556 XP_001371949.1.35504 XP_007472690.1.35504 XP_007472691.1.35504 XP_007472692.1.35504 XP_016283096.1.35504 ENSMODP00000003556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]