SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003690 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003690
Domain Number 1 Region: 641-826
Classification Level Classification E-value
Superfamily Fibronectin type III 3.22e-35
Family Fibronectin type III 0.0000702
Further Details:      
 
Domain Number 2 Region: 1051-1143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-25
Family I set domains 0.0092
Further Details:      
 
Domain Number 3 Region: 933-1025
Classification Level Classification E-value
Superfamily Fibronectin type III 4.19e-23
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 83-185
Classification Level Classification E-value
Superfamily Immunoglobulin 2.83e-18
Family I set domains 0.00000338
Further Details:      
 
Domain Number 5 Region: 556-649
Classification Level Classification E-value
Superfamily Immunoglobulin 9.15e-18
Family I set domains 0.00094
Further Details:      
 
Domain Number 6 Region: 360-452
Classification Level Classification E-value
Superfamily Immunoglobulin 7.67e-17
Family I set domains 0.000022
Further Details:      
 
Domain Number 7 Region: 458-548
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000211
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 285-367
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000436
Family I set domains 0.00045
Further Details:      
 
Domain Number 9 Region: 852-941
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000134
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003690   Gene: ENSMODG00000003026   Transcript: ENSMODT00000003773
Sequence length 1163
Comment pep:novel chromosome:BROADO5:8:81170063:81281271:1 gene:ENSMODG00000003026 transcript:ENSMODT00000003773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPTKKEENEAPAPPPEEPSKEKEGGSGPPKGEGDVSPPSALPADINARALARKDSEWS
LGESPVGEEQDKQNSNTSQSALFVEKPQNGTVKVGENITFIAKVEAKDLLRKPTVKWFKG
KWMDLASKAGKHLQLKETFERQTRMYTFEMQIIKAKENYAGNYRCEVSYKDKFDSCSFDL
EVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPEIDVWELLKNA
NPNEYEKIAFQYGITDLRGMLKRLKRMRRVEKKSAAFSKILDPAYQVDKGGKVRFVVELA
DPKLEVKWYKNGQEIRPSTKYIFEHKGNQRIMFINNCQMTDDSEYYVTAGDEKCSTELFV
REPPIMVTKQLEDTNAYCGERIELECEVSEDDANVKWFKNGEEIVIGPKSRYKVKVEGKK
HTLIIEGATKADSAEYSVMTTGGQSSCKLSVDLRPLKILQPLTDVTVKLGKEICLKCEIS
ENISGKWTKNGLPVQEGERLKVVHKGKIHKLVIANALIEDEGEYVFAPDAYTVTLPAKVH
VIDPPKIYLDGLEADNTVTVIAGSKLRLEIPVSGEPAPKALWSRADKAIAEGGGRIRAES
YPDSSTLVIDVAEREDSGVYNINLKNEAGEAHASIKIKVVDIPDPPLAPNVSDVGDDWCI
MNWEPPANDGGSPILGYFIERKKKQSSRWMRLNFDLIKETTFEPKKMIEGVAYEVRIFAV
NAIGISKPSMPSKPFVPLAVTSPPTLLAVDSVTDSTVTMKWRPPDQIGAAGLDGYVLEYC
FEGTEDWIVANPELTDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYGQPILVKEIIE
PPKIRIPRHLKQTYLRRVGEAVNLVIPFQGKPRPELTWKKDGADIDKNQINIRNSETDTI
IFIRKAERSHSGKYDLEVKVDKYVDSASIDIQIVDRPGPPQSVKIEDVWGENAALVWTPP
KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTNATITELVIGNEYYFRVFAENMCGLSE
EATMTKESAVIAKDGKVYKNPVYDDFDFTEAPMFTQPLVNTYAIAGYNATLNCSVRGNPK
PKITWMKNKVAIVNDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNELGTVEIECKLE
VKVIYQGLITPGQPLFLAGQQQL
Download sequence
Identical sequences F6Q0H5
XP_007503378.1.35504 ENSMODP00000003690 ENSMODP00000003690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]