SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004261 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004261
Domain Number 1 Region: 71-119
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000031
Family Viral proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004261   Gene: ENSMODG00000003487   Transcript: ENSMODT00000004351
Sequence length 411
Comment pep:novel chromosome:BROADO5:1:71199190:71220707:1 gene:ENSMODG00000003487 transcript:ENSMODT00000004351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLFFSPLKAVLTSPGIRLLATRGAPRCGSHYGQKLPLLQRQYSTASEIALQSGRRAVP
IPTKATERIMGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWET
EFQKYQQFPEFKILNHDMTLAEFKFIWYMEYSHRMWGRIVGLAYILPAAYFWRRGWLTSG
MKGRVLSLCGLVCFQGLLGWYMVKSGLEEKPDSHDIPRVSQYRLAAHLGSALVLYCASLW
TALSLLLPRDKLPETRQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGER
WIPEDLFTFSPVLKNVFENPTMVQFDHRILGITTVTAITGLYFLSRRIPLPRRAKMAVAT
LLTVAYAQVGLGISTLLMYVPTPLAAVHQSGSLALLSVALWLMNELRRIPK
Download sequence
Identical sequences F7CSQ7
ENSMODP00000004261 13616.ENSMODP00000004261 XP_007478708.1.35504 ENSMODP00000004261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]