SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004406 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004406
Domain Number 1 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 4.31e-37
Family Link domain 0.00000236
Further Details:      
 
Domain Number 2 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-37
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004406   Gene: ENSMODG00000003606   Transcript: ENSMODT00000004500
Sequence length 277
Comment pep:novel chromosome:BROADO5:4:153787951:153815744:1 gene:ENSMODG00000003606 transcript:ENSMODT00000004500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIALIYFFVLLWDEAQSWGFKDGIFHNSIWLEQAAGVYHREARAGKYQLTYAEAKAVCEY
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGYGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIIKSPGYPKEYEDNQICYWHIRLKYGQRIHLSFLNF
NLEDDIACLADYLEIYDSYDDIHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QLKYVTVDTTPKTGEGKNASTNSHGNKNFLAGRFSHL
Download sequence
Identical sequences F7C6K7
13616.ENSMODP00000004406 ENSMODP00000004406 XP_001365272.1.35504 ENSMODP00000004406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]