SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005139 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005139
Domain Number 1 Region: 264-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.26e-22
Family Complement control module/SCR domain 0.00000986
Further Details:      
 
Domain Number 2 Region: 83-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-17
Family Complement control module/SCR domain 0.0000649
Further Details:      
 
Domain Number 3 Region: 205-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000103
Family Complement control module/SCR domain 0.0000509
Further Details:      
 
Domain Number 4 Region: 140-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000103
Family Complement control module/SCR domain 0.0000994
Further Details:      
 
Domain Number 5 Region: 22-80
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000418
Family Complement control module/SCR domain 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005139   Gene: ENSMODG00000004169   Transcript: ENSMODT00000005249
Sequence length 345
Comment pep:novel chromosome:BROADO5:2:226998587:227019905:-1 gene:ENSMODG00000004169 transcript:ENSMODT00000005249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPVLALLVSFLCHCVIEGRNCPKPQELPFSTVVPLKWSYEPGEQILYSCKPGYVSRGG
MRRFTCPLTGMWPINTLKCQPRICPFAGVLENGVVRYTTFEYPNTVNFTCNKGFHLNGTA
SVKCTEEGRWSHSLPICSPITCPPPSIPNFATLKLHGTSAKNISFYQDTAGFDCLPHYAM
FGNDTITCTENGNWTELPECREVKCPFPTRPDNGFVNYPANTALYYKDKATYGCHETYAL
DGPEEVECGKFGTWSASPTCKASCKIPVKKATVLYKGEKVNIQDKLKNGILHGEIISFFC
KNKEKKCSYTEDAQCLDGNLEIPSCFKEHSSWAFWKTDASDREPC
Download sequence
Identical sequences F6QPV8
ENSMODP00000005139 ENSMODP00000005139 13616.ENSMODP00000005139 XP_001370229.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]