SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006472 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006472
Domain Number 1 Region: 87-298
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-53
Family DBL homology domain (DH-domain) 0.0000923
Further Details:      
 
Domain Number 2 Region: 315-431
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-19
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006472   Gene: ENSMODG00000005248   Transcript: ENSMODT00000006607
Sequence length 527
Comment pep:novel chromosome:BROADO5:2:136506069:136507652:1 gene:ENSMODG00000005248 transcript:ENSMODT00000006607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHDEIGSFLPIKRTIRVLDVNNQSFREQEEPSNKRVRSLARVSSLANLISPVRNGAVK
RFGQTIQKSFNRATVPTPSKRRNSVRWSEMLDINMKESLTTKEIKRQEAIYEMLQGEQDL
IEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARLGEATKPDGTVEQI
GHILVNWLPGLNAYRGYCSNQLAAKALLDQKKQDARVQDFLQRCLESPFSRKLDLWSFLD
IPRSHLVKYPLLLKEILRHTPKDHTDIKPLEEALLVIQGVLSDINLKKGESECQYYIDKL
EYLDDKQKDPRIEASKVLLCHGELKNKNGHKLYIFLFQDILVLTRPVIRNERHSYQVYRQ
PIPVKELVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRFRDPSPGQSHTLQANDVFHK
QQWFNCIRTAIAPFHQTTSPTEFKGLSELNKGSEKNNPLASHIKSQRKSSTLSGLIPLEV
DENSPECIPSIAINENSTDIKAHRIQPGSPKAQEKAQLNDKRKETLV
Download sequence
Identical sequences F6YM83
ENSMODP00000006472 13616.ENSMODP00000006472 ENSMODP00000006472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]