SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006646 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006646
Domain Number 1 Region: 21-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000131
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Domain Number 2 Region: 125-175,253-315
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000272
Family I set domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006646
Domain Number - Region: 175-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0364
Family C1 set domains (antibody constant domain-like) 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006646   Gene: ENSMODG00000005386   Transcript: ENSMODT00000006784
Sequence length 493
Comment pep:novel chromosome:BROADO5:2:456931177:456940697:-1 gene:ENSMODG00000005386 transcript:ENSMODT00000006784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPPCFPAGLCQAGKLETTPLVTVVLGQDAELPCFYRGEPEEQVKQVAWARVEEKKGPT
ELALLHDTYGLHVGSSYDGRVERPPSPRDPNDGAILLRNAVQADEGDYECRVSTFPSGSF
QAGLHLRVLVPPLPTLNLGPALEEGQGRTLAASCTAEGSPMPNVTWDTVVKGSSTRRFSS
HPRSASVTSEFYLVPSRTMNGQPITCVVSHPGLPESKRITHTLQVAFLAEASVWGHEDPE
LWHVGREGVMLKCLSEGQPPPSYNWTRLDRPLPSGVRVDGGTLGFPPLTPEHSGTYVCHV
SNEVSSRNSQVTVAVTAENEAPPVDVDVVSASMVAVGVIAGLLLCLLVVVVLLMSRYHRR
KAQQMTQKYEEELTLTRENSIRRLHSHHSEPRNQPEENVGLRAEGHPDSLKDNSSCSVMS
EEPEGRSYSTLTTVREIETQTELLSPGSGRTDEEEDRDAGIKQAMNHFVQENGTLRAKPT
GNGIYINGRGHLV
Download sequence
Identical sequences F7GGF7
XP_001381674.1.35504 ENSMODP00000006646 ENSMODP00000006646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]