SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007886 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007886
Domain Number 1 Region: 700-888
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-41
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 2 Region: 1112-1205
Classification Level Classification E-value
Superfamily Immunoglobulin 4.98e-22
Family I set domains 0.0062
Further Details:      
 
Domain Number 3 Region: 615-704
Classification Level Classification E-value
Superfamily Immunoglobulin 9.9e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 978-1082
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-18
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 67-159
Classification Level Classification E-value
Superfamily Immunoglobulin 6.8e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 911-1000
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-16
Family I set domains 0.0083
Further Details:      
 
Domain Number 7 Region: 417-494
Classification Level Classification E-value
Superfamily Immunoglobulin 5.72e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 235-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000303
Family I set domains 0.036
Further Details:      
 
Domain Number 9 Region: 330-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000592
Family I set domains 0.031
Further Details:      
 
Domain Number 10 Region: 518-604
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000859
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007886   Gene: ENSMODG00000006354   Transcript: ENSMODT00000008045
Sequence length 1225
Comment pep:novel chromosome:BROADO5:5:242243941:242265419:1 gene:ENSMODG00000006354 transcript:ENSMODT00000008045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTIQQQMVKEHVSMEFSSSTTSVQTFSQTTKAIGEQITSQKSSSHTEFFSLITRSSEV
PAGESVPEFVEKPSPVTSPEGDKAVFRARVQGNPKPNVSWKRESGIPIKESAKIFYDSIN
KEYVLKLEPLSSDDADNYKCIASNEHADAVYTVSLTVSESQEKMDFKKMLKKRGPPAPKK
QQKKVTDEKEMLEILSKVPKKDFEKVCMEYGFRDFRGLLKKLKEMKKKVEVEAIRIIKPL
EDVEAKVDSTVTFDCIMELKDPNTKMIWIKGMEPLRIQYSLGKYDVKQVGTKYMLIITNV
NMNDAGIYTLAVGDKRLSAELIVLDEPLKFIGEMKPLKVTERQTAVFEIRLSKKVPNFVW
KFNGKELKRDDKYEISVSEDGLTHTLKIKDARLSDSGEFSVEAGDLVQKAPLTIDRIPIK
FVSTLKNARVKERSRACLECELTSKDVTLRWKKDGKLLERGTKYSMSHEGKRAELVIEDA
QLSDGGEYTVVAMQDGDPTEYYSTAILTVEERLATVKSGMSDVHAATGSPAELCVVLNDE
KVEGVWLKDGKEITDFSGVQIVKQGAVHKLIFPNMGPEHEGKYTFRAKGAESEASVFIAD
PPTIDPSVLEALAAHPVTVKVGQTANIKVPFRAKPLPKATWYKDGVEVTEEERVTMERGD
DQALLTISNCVREDSGVVLLKLKNDHGSATATLHLNVLEPPGLSSQPQVSDVTKEAVTIT
WNPPTQDGGSPVLGYIVERRKKGSNLWVPVNKDPIQDTKCKVDGLLEDTEYEFRVIAVNR
AGQGQPSMPSTSVVAKDPIKPPGLVQGLHVADSSNSSISLAWREPIEGDPPSGYILEMRA
EDTKEWSKCTKIPISGTCYTVGGLTERQKYFFRIRAVNEGGVGEPVELDEGVRAMPPPAA
PRFDLSARLKSHMVVRAGTALCIHASFYGSPPPTVIWQKDGIPTKGRETITKGKNHSQFL
INSTKRSDSGVYRILLRNEYGEAHYDIHVRVADFPRPPTNLKLFEEVPNTVTLGWDHSPD
VQEDGEAHYVIMKRDASTATWFTAADRVFSNKYTVTGLLPGRKYYFRVLARNEIGDSDPL
DSKDTWLVNKDEIEDLGAKLRPYEHKDWRHAPRFITPLKPHTVLRGHDCTMSCAFLGNPR
PTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLIENELGKDKSSCTLT
VYDKDDKSILASVTESLQKKSKHLM
Download sequence
Identical sequences F6ZRK4
ENSMODP00000007886 ENSMODP00000007886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]