SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008785 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008785
Domain Number 1 Region: 20-116
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-31
Family V set domains (antibody variable domain-like) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008785   Gene: ENSMODG00000028442   Transcript: ENSMODT00000008958
Sequence length 125
Comment pep:novel chromosome:BROADO5:3:524357567:524358470:1 gene:ENSMODG00000028442 transcript:ENSMODT00000008958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLSFCSGSLSQAVLTQPPSVSAALGSSARLSCTLSSQHRDYAVGWYQQSPG
KPPRYLLYVTSSGGTSRGDGIPERFSGSGSGTDRFLSISSVQAEDEADYFCGYDYGSGSS
YRYPQ
Download sequence
Identical sequences F6UEN4
ENSMODP00000008785 ENSMODP00000008785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]