SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008846 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008846
Domain Number 1 Region: 1005-1221
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-37
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 
Domain Number 2 Region: 1376-1575
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-33
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 1207-1322
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-21
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008846   Gene: ENSMODG00000007131   Transcript: ENSMODT00000009020
Sequence length 1577
Comment pep:novel chromosome:BROADO5:6:247618614:247814852:-1 gene:ENSMODG00000007131 transcript:ENSMODT00000009020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNAESPKPPLAPKPKTTGHFTPAVSKFPPSSRSDILHSPNSMSRGPKPPIAPKPKLATT
NRGKTRVYMNNTFNKFSNGKLICSDGELYEGNQSNPECSESEADDDYILVTETQLTKGSF
KILEQEPCCAENEKPASLSATREEETEAEDPSSSNCSSSFEAKVEETEEDSLSSTDRVDD
SNELALGGDYKRTDSSFQGSPGETETQDPMYENTGEDIDYENDPDEKDKLFVRKERDSLI
ENQYGYSLEEEREDCKDIVLTHIASEEPEASGEQPGDPEESLDVGDANSEGYADAEPSSS
DCYGVSNIPPAGGEDEAKNEFNEELEPCDELSKTGLAVEDSEITDWEKEDLVDNGDQDAE
TKDDQEEEAAVQGMGEDIQNGEDMLKDEVADESCQIIPFESEGGDELLDSLSGNSFAFLP
TESTSFCSDSYYPLSESVKESEMGAEMDLGSASMGFLVTGSRIETTLKETHEIIGEADDV
SGDDVNLPGQMQDNEQAPLTGLVNNQSGSPDDEAFEVPAVVIVPEETLDDETVDDSLIDP
YVMGVSLIHRDENSFPGGRGHSETKGEEGTQNNCSTKEEINADADSGLITMDRKNIVTRA
RSHSGKVPGYVPETVPEETGPETDLLSMDSRHTVQEGNKTWLPMEGKPLEINRALPAKPR
SFILYPRSFSVEGRDLPVSLYRELEESILDEGRIKRKEDNLSLPCVIGSSGSFSQRSHLS
SSGMSTPSSVVDIPPPFDLACITKKPITKSSPSLLIDNDSPDKYTKKKKSSFKRFLALTF
KKRTENKVHVDVNVSSSRSSSESSYHGPSRVLEIDRRSLSNSPQLKSRSGKLRASDSPSS
IIFYRDIKRKGAPFSRSVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMN
SDYENIQIPPRRPTRAGTFTKLFEDPSRALSTANENDGYVDMSSFNAFESKQQTTDQETE
SAYTEPYKVCPISAVPTEDVTSDEEQKSSEEEESSQREPGLTHKKEGQSRAYVIAQELLS
SEKAYAQVLQHLMLDFHEAILKALSEETEDNEESLARGELRQGLSELPAIYELHQEILSE
MEERILNWEEQPKVADIFLTQAPKFDHHVAYIMKFDKNLTLLNGNCIKSSQLTTTLREFE
NPQSGGQGVKHQLLKVVEHIFQYQVLLTDYLNNLCPDSAEYENTQDALALISKVTDRAND
SMEQGENLQKLVHIEHSVRGQNNLLQPGREFLTEGTLMKVTGKSRHPRHLFLMSDVLLYT
FPQKDGKYRLKNTLTVSSMRVSRPVMEKVPYALKIESAETCLMLSASSCSERDEWYSCLI
RTLPEGYQMHTLAAFHNSVEIRERLGICLGERPPTLVPVSHVMMCMNCGCDFSLTLRRHH
CHACGKIVCRNCSRNKYPLKYLKDRLAKVCDGCYAELKKRGGDIPGLLKERPVSMSFPMS
SSRFSSGAFSSVFHSINPSAFKKQKKIPSALTEVAASAEGSAISGYLSRRKKGKRHWKTL
WFVIKGKVLYTYMASEDKVATESIPLLGFTIAPEEGNRDLGLVFHLYHKQTLFYSFKAED
TNSAQRWVEAMKDATVL
Download sequence
Identical sequences F6RZS2
XP_007500330.1.35504 ENSMODP00000008846 ENSMODP00000008846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]