SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008860 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008860
Domain Number 1 Region: 81-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000419
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 41-83
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000432
Family Somatomedin B domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008860   Gene: ENSMODG00000007144   Transcript: ENSMODT00000009034
Sequence length 271
Comment pep:novel chromosome:BROADO5:3:163574294:163634223:1 gene:ENSMODG00000007144 transcript:ENSMODT00000009034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFTMRTLSSGLWMALWGLARLWAGAQAGCSEVGRCCPGRDATCFGRGWRLDRVYGTCYCD
QACQLTGDCCFDYSRACPARPCIVGEWSSWSSCTDQCKPATRVRRRYVQQEPQNGGEPCP
HLEEKAGCLEYTTSHGQDCGHSYVPAFITTSAYNKERKRQVVSPQWSADTGDAGYCMEFK
TESLTHYCAMENRPLTRWMQYLREGYTVCVDCQPPAMNTVNLRCSGDGLDSDGNQTLHWQ
AIGNPRCQGTWKKVRRVDHCSCPAVHSFIFI
Download sequence
Identical sequences F6RYM8
13616.ENSMODP00000008860 ENSMODP00000008860 ENSMODP00000008860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]