SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008975 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000008975
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.0392
Family Inhibitor of apoptosis (IAP) repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008975   Gene: ENSMODG00000007240   Transcript: ENSMODT00000009152
Sequence length 69
Comment pep:novel chromosome:BROADO5:5:302037169:302176038:-1 gene:ENSMODG00000007240 transcript:ENSMODT00000009152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDHPTSPHTPQTPHCHSLRTTKSDFYIWSRFKFLPCLFFFFFLKQFSKVLKGKSEFLWI
LLVPALRFF
Download sequence
Identical sequences F6WBS5
13616.ENSMODP00000008975 ENSMODP00000008975 ENSMODP00000008975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]