SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009427 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009427
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-60
Family DBL homology domain (DH-domain) 0.0000175
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-33
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 382-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-29
Family DEP domain 0.0029
Further Details:      
 
Domain Number 4 Region: 477-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.12e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000434
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 581-673
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000565
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009427   Gene: ENSMODG00000007595   Transcript: ENSMODT00000009612
Sequence length 1606
Comment pep:novel chromosome:BROADO5:3:169024399:169440015:-1 gene:ENSMODG00000007595 transcript:ENSMODT00000009612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESKGEGKGESGKDLEKQLRLRVCVLSELLKTERDYVGTLEFLVSAFLHRMIQCAASK
VDKNVTEETVKMLFSNIEDILSVHKEFLTVVEECLHPEPNAQQEVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLL
KELLKRTPRKHSDYAVLMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMYGVLLKISAGNIQERVFFLFDNLLVYCKRKHRRLKNSKTSIDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHIVINGWKIHNTAKNKWFVCMAKTPEEKHEWLEAIMKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCQQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHKPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE
GSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL
NSKKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPMKQDSIQWVYNSIESAQEDLQKTNSKPPGDDG
GDAFDCKVEEVIDKFNTMAIIDGKKDHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI
EPKGFFSLTAKILEALAKSDEHFVQNCTSLNTLNEVIPTDLQSKFGTICSDKIEHICRRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGV
QLDNRKHNSHDKENKVSEQGKLNPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDL
ETQDIYQKLLGKLQTALKEVEICVCQIDDLLSSITYSPKLEHKTSESLIPTDSDNEKGER
NGKKVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GDELPLSIRISHDKQDKLHGCLEHLFSQVDSITNLLKGPAVVRVFEQTKYFTPGRGLQEF
QQEMEPKLSCPKRLRLHIKQDPWNLPSSVRNLAQNIRRFVEEVKSRILLALLEYTDSEIQ
LRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHF
QSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFRPAEQDPLVANMPLTYQAEGSRQALRVY
FYIDSYHFDQLPQRLKNGGGFKVHPVLFAQALESMEGYYYRDSVSVEEFQAQINAASLEK
VKQYNQKLRAFYLDKSNSPPNSTSKAAYIDKLMRPLNALDELYRLVISFIRSKRTAACAY
TACSASGVGLLSVSSELCNRLGACHIIMCNSGVHRCTLSVTLEQAIILARSHGLPPRYIM
QATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCQPPPPAGEE
Download sequence
Identical sequences F7CPA6
ENSMODP00000009427 XP_007487071.1.35504 ENSMODP00000009427 13616.ENSMODP00000009427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]