SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009986 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009986
Domain Number 1 Region: 332-562
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-51
Family Kelch motif 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009986
Domain Number - Region: 176-220
Classification Level Classification E-value
Superfamily PH domain-like 0.00799
Family TFIIH domain 0.025
Further Details:      
 
Domain Number - Region: 21-80
Classification Level Classification E-value
Superfamily PH domain-like 0.0197
Family GRAM domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009986   Gene: ENSMODG00000008022   Transcript: ENSMODT00000010178
Sequence length 574
Comment pep:novel chromosome:BROADO5:4:179084349:179134757:1 gene:ENSMODG00000008022 transcript:ENSMODT00000010178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLDALWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWH
SLALPRVNLSVGYNCIINITTRTANSKLRGQTEALYILTKCNNTRFEFIFTNVVPGNPRL
FTSVISVHRAYETSKMYRDFKLRSALIQNKQLKLLPQEQVYDKINGVWNLSSDQGNLGTF
FITNVRIVWHANMNDNFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV
EKLQESVKEINSLHRVYSASPIFGVDYEMEEKPQPLEDLTVEQIQDDVEIDSDEHTDAFV
AYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEFDNVAAEWVGLPPLPSARCLFG
LGEADDKIYVVAGKDLQTEASLDSVLCFDPVAIKWNEVKKLPIKVYGHNVVSHNGMIYCL
GGKTDDKKCTNRVFIYNSKKGDWKDLAPMKTPRSMFGVAIHKGKIVIAGGVTEDGLSASV
EAFDLTTNKWEVMPEFPQERSSISLVSMAGSLYAIGGFAMIQLESQEFAPTEVNDIWKYE
DDKKEWTGMLKEIRYASGASCLATRFNLFKLSKL
Download sequence
Identical sequences F7CKZ1
ENSMODP00000009986 ENSMODP00000009986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]