SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010535 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010535
Domain Number 1 Region: 509-748
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-44
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 865-1025
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-33
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-28
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 734-856
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-26
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Domain Number 6 Region: 42-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-23
Family First domain of FERM 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010535   Gene: ENSMODG00000008474   Transcript: ENSMODT00000010741
Sequence length 1042
Comment pep:novel chromosome:BROADO5:7:99630877:99908614:-1 gene:ENSMODG00000008474 transcript:ENSMODT00000010741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEQKPTPGSRLGAPENAGISTLEHGQKLPTAPPGKLISIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHAQLQEELTRYLFALQVKQDLAQGRLTCNETSAALLISHIVQSEIGDFDETVDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQVLDYVKEGGHKKVP
FERKHSKIRSIRSLSAQPSEQNSEVPKQSSSFTYGDGADSPGAQSCHQGKELNISAEEPE
QHRSPSLKKSPKDGQHVDGVVMATMEEEEEVVKDRTRQSNPQSQQPSTGSLTGSPHLSEL
SINSQGGPTAANMTLSPNLSPDTKQSSPLVSPLLNDQTCARTDDEEEVRRKRFPTDKAYF
IAKEVSTTERTYLKDLEVITSWFQSTVSKDESMPETLKSLIFSNFEPLHKFHSSFLKEIE
HRLALWEGRSNAQMKGDYQRIGDVMLKNIQGMKQLTSHLWKHNEALVELENGIKNSRRLE
SFCREFELQKVCYLPLNTFLLRPLHRLMHYKQIMERLCKHYPPNHSDFRDCRAALAEITE
MVAQLHGTMIKMENFQKLHELKKDLIGIDNLVIPGREFIRLGSLSKLSGKGLQQRMFFLF
NDVLLYTSRGLTATNQFKVHGQLPLYGMTIERSEEEWGVPHCLTLCGQHQSIIVAASSRI
EMEKWIEDIQMAIDLAEKSSGPTPELLASSPPDNKSPDDAMADQESEDDLSASRTSLERQ
SPHRGNTMVHVCWHRNTSVSMIDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFF
YKSHQDNHPLASLPLLGYSLTIPSEAENIHKDYVFKLHFKSHVYYFRAESEYTFERWMEV
IRSATTSASRACVLSHKESHVY
Download sequence
Identical sequences F7GEK9
ENSMODP00000010535 ENSMODP00000010535 XP_007501433.1.35504 XP_007501434.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]