SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010618 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010618
Domain Number 1 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-19
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 6 Region: 48-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.24e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 7 Region: 225-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000117
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010618   Gene: ENSMODG00000008540   Transcript: ENSMODT00000010825
Sequence length 524
Comment pep:novel chromosome:BROADO5:2:251733120:251756752:1 gene:ENSMODG00000008540 transcript:ENSMODT00000010825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTPKELTMEKSTQVIEEEAQSFRDSSLPQERKTQEVGTAALQLTARSHELVTFKDVAM
DFTPEEWGQLDPAQRDVMLENYRNLVSLWLPVSKPDGSSNFDQGENQWMMERKVPRGTRP
DWDTRSESRESTSVQEISEEESSQGVIVGRVTEDDVSNLEECEDWLERQQENERHLRQVT
IAQRKNLTKERDSECNTYWKNFNQRSVIVNQEKIPTGENLGNFERKTFKQNSNLMKNQRI
YKEKKPCKCNECGESFSYHSVLIRHQRIHTGEKPYMCNNCGKAFSHKANLKKHLKTHTRA
RLYTCNACGKTFTESLAFSEHQKTHIGERPYECNECGKAFSRTSHLIQHKMIHTGEKPYQ
CNECDKAFIHSSALIKHQRTHTGEKPYTCNECGKAFSHCSSLTKHQRVHTGEKPYECNEC
GKTFSQSTHLVQHQRIHTGEKPYECNECGKTFSRSSNFAKHQRIHSGKKPYECNECGKAF
IHSSALIQHQKTHTGEKPYKCNECVKTFKCSSSLLRHQRLHTGE
Download sequence
Identical sequences F7DH93
ENSMODP00000010618 ENSMODP00000010618 XP_007483151.1.35504 XP_007483152.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]