SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011200 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011200
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily Immunoglobulin 6.36e-19
Family V set domains (antibody variable domain-like) 0.00012
Further Details:      
 
Domain Number 2 Region: 216-312
Classification Level Classification E-value
Superfamily Immunoglobulin 5.16e-17
Family V set domains (antibody variable domain-like) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011200   Gene: ENSMODG00000008983   Transcript: ENSMODT00000011417
Sequence length 318
Comment pep:novel chromosome:BROADO5:3:433893929:433901667:1 gene:ENSMODG00000008983 transcript:ENSMODT00000011417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQFSVIGPTEPIRAWVGRTADLPCYLSPQKNAQSMKVIWFQSLEIVHHYEDGQDKFDNQS
PKFQGRTELVKDAISRGNVTLRIWNITAADKGHYKCHFDDGLYQEEAGIELLVSGEDNIP
KINVLAHNDERIVRQQNSYGLKMLEPVSWRSILGEKVVTKGIHMVRPGHFCSSNKLSVSL
LSFPKSSQYPYHPVLSSLVSSIGSAPFSFQVPSSQFSVIGPTERIRAWVGRTADLPCYLS
PQKNAQAMKVIWFQSLEIVHHYEDGQDKFDDQSPKFQGRTELVKDAITRGNVTLRIWNIT
ASDQGHYKCHFDDGLYQE
Download sequence
Identical sequences F7BQG4
13616.ENSMODP00000011200 ENSMODP00000011200 ENSMODP00000011200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]