SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012498 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012498
Domain Number 1 Region: 2227-2464
Classification Level Classification E-value
Superfamily Plakin repeat 1.83e-84
Family Plakin repeat 0.000000000613
Further Details:      
 
Domain Number 2 Region: 1984-2218
Classification Level Classification E-value
Superfamily Plakin repeat 4.71e-75
Family Plakin repeat 0.00000245
Further Details:      
 
Domain Number 3 Region: 2538-2578,2625-2819
Classification Level Classification E-value
Superfamily Plakin repeat 1.92e-68
Family Plakin repeat 0.0000000115
Further Details:      
 
Domain Number 4 Region: 853-981,1008-1035
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000216
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 5 Region: 343-472
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000115
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 6 Region: 2476-2531
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000942
Family Plakin repeat 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012498
Domain Number - Region: 206-292
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00259
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012498   Gene: ENSMODG00000009982   Transcript: ENSMODT00000012726
Sequence length 2883
Comment pep:novel chromosome:BROADO5:3:336887346:336936959:-1 gene:ENSMODG00000009982 transcript:ENSMODT00000012726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCNGGSHSRINTLGRMTRAESGPDLRYEMTYGGGGGGGGGGGGGGGGGGGSNNRMCYMR
RCTVNDQNSDGYCQTGGTMSRHQNQNTIQELLQNCADCLMRAELIVQPELRYGDGVQLSR
SRELDECFAQANDQMEITDGLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISGPRVRK
ASSRGGGGYTCQSGSGWDEYTKRLTSECLGWMRQQRAEMDLVIWGVDSASVEQHINSHRV
VHNVIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASLERMDHLRQLQSIIQATSREI
MWINDCEEEELLYDWSDRNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPA
SDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKY
TCDKNMSLQRLLEQIKELEKEREKILEYKRQVQNLVNKSKKIIQLKPRNPDYRSNKPIIL
RALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLS
CKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTISDL
ELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGHHQHQTVTEVTHVGS
CKEPIQNQNQVIEINRENDKQETWILLELQKVRRQIEHCENRMTIKNILQADQGSSHHIT
VKINELKSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEIYGLFQKLENINGVTDGY
LNSLCSVRGLLQAILQTEDTLKVYESRLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKS
LLATMKTELQKAQQIHSQTSQQYPLCDLDLGKFSDKVSQLSDRWQRIDKQIDFRLWDLEK
QIKQLRNYRDNYQAFCKWIYDAKRRQDSLESMKFGDSCTVMKFLNEQKALHNEISGKRDK
SEEVQKIAELCAHSIKDYELQLASYTSGLETLLNIPIKRTMVQSPSGVILQEAAEIHARY
IELLTRSGDYYRFLSEMLKSLDDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQ
KYQAECSQFRAKLVSLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKR
KRKTVEDRFDQQKNDYDQLQKARQCEKENLGWQRLESEKTIKEKEYEIERLRVLLQEEGA
RKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDTKGLKNQVDRLS
RENRDLKDEIVRLNDSILQTTEQRRRAEENAIQQKACGSELMQKKQQLEIELKQVIQQRS
EDNTRHKQSLEEAAKTIQDKNKEIERLKTEYQEEAKRRWDYENELGKVRNNYDEEIISLK
NQFETEINITKTTIHQLTKQKEEDTSGYRTQIDNLTRENRSLSEEIKRLKNTLTQTTENL
RRVEENVQQQKATGSEMSQRKQQLEFELKQVTQMRSEESMRYKQSLDDAAKTIQDKNKEL
ERLKKLIETETNQRKCLEEENSKLQRTQYDLQKANSNATETISKLKIHEQELTRLRIDYE
RISQERTIKDQDISRFQSSLKDLQFQKQKVEDELNRLKKTASDECSKRKKLEDELESMRR
SLKEQAIKITNLTQQLEQASITKKRSEDDLRQQRDVLDGHVREKQRTQEELRKLASEVEA
LRRQLVQEQENVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEE
LRNLRLEYDDLRRGKSEADCDKNATISDLRSQLQISTNRTLELQGLINDLQRERENLRQE
IEKFQKQAIEASNRIHESKNQCSQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKATL
ESEIRVKQRLENEKQQIQNDLNQWKSQYSRKEEAMRKFESEREKSEREKNCLRSEIERLQ
AEIKRIEDRCRRKLEDSTRETQSQMESERCRMQREIDRLKQRPYGSHRETQTEEEWSVDP
SKLIFDGLRKKVTAMQLYECQLIDKSTLDKLLRGKKSVEEVASEIQPFLRGAGAIAGASA
SPKEKYSLVEAKRKKLITPESTVMLLEAQAATGGVIDPHRNEKLTVDNAIARDLIDFDDR
QQIYTAEKAVTGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVIDPINSVFL
PKDVALSRGLIDRDLYRSLNDPRDSQKNFVDPINKKKVSYVQLRERCRIEPHTGLLLLLV
QKRSMSFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGI
YNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAHKRGLVGI
EFKEKLLSAERAVTGYKDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKES
HRLPVDMAYKRGYFNEELNEILSDPSDDTKGFFDPNTEENLTYLQLKERCMKDEETGLCL
LPLKEKKKPIQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYDTFVELCEQECEW
EEITITGSDGSTRVVLVDRKTGSQYDIQDAIDKGFVDRKFFDQYRSGSLSLTQFADMISL
KNGGSSVGSGSGGDDVFSSTRHDSITKTSSISSIRNLTIRSSSLSDPLEETSPIAAIFDT
ENLEKISITEGIERGIVDSITGQRLLEAQACTGGIINPTTGQRLSLQDAVSQGLIDQDMA
TRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRI
SSEEAIRKGLIDGRGAQRLHDTSNYAKILTCPKTKLKISYKDAMNRSMVEDITGLRLLEA
ALVSSKGLPSPYNVSSAPGSRSGSRSGSRSGSRSGSRRGSFDASGNSSYSSYSYTFSSSS
IGH
Download sequence
Identical sequences F6Y796
ENSMODP00000012498 XP_001377978.1.35504 ENSMODP00000012498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]