SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014272 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014272
Domain Number 1 Region: 6-160
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 8.1e-21
Family MHC antigen-recognition domain 0.00079
Further Details:      
 
Domain Number 2 Region: 168-257
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-16
Family C1 set domains (antibody constant domain-like) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014272   Gene: ENSMODG00000011414   Transcript: ENSMODT00000014536
Sequence length 259
Comment pep:novel chromosome:BROADO5:1:705610150:705616304:-1 gene:ENSMODG00000011414 transcript:ENSMODT00000014536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HELQFIAVGTSQGLLELSAIAFIDDIQWASYGKPLQQIKVKHAWISEALGRQFLKEMQYQ
MTDQEEGYHRFIQHLTRNDRSKNHRTLQFYLNCELNEDIPLKYHVKYGFDGEDFIETNEK
GKWKVLHHWAIGSEIFFESPAVFEQFNKIYCIGVMQKILQKSSLKENRPPDMYVSHQEFP
NGTITFSCTATGFYPQAIQMSWKKADNGTVVGKEDSSGILPNSDDTFYLQISLEVQPGEP
RTGYACVVDHSQLEAPAVL
Download sequence
Identical sequences F6RL31
ENSMODP00000014272 13616.ENSMODP00000014272 ENSMODP00000014272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]