SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014301 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014301
Domain Number 1 Region: 1266-1321,1364-1438
Classification Level Classification E-value
Superfamily Immunoglobulin 9.03e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 889-955,999-1073
Classification Level Classification E-value
Superfamily Immunoglobulin 2.33e-19
Family V set domains (antibody variable domain-like) 0.093
Further Details:      
 
Domain Number 3 Region: 707-769,812-888
Classification Level Classification E-value
Superfamily Immunoglobulin 2.64e-17
Family I set domains 0.045
Further Details:      
 
Domain Number 4 Region: 519-630
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 25-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000527
Family V set domains (antibody variable domain-like) 0.0000532
Further Details:      
 
Domain Number 6 Region: 333-416
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000978
Family I set domains 0.041
Further Details:      
 
Domain Number 7 Region: 1073-1159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000152
Family I set domains 0.033
Further Details:      
 
Domain Number 8 Region: 247-319
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000059
Family I set domains 0.048
Further Details:      
 
Domain Number 9 Region: 407-510
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000861
Family I set domains 0.048
Further Details:      
 
Domain Number 10 Region: 1443-1526
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000179
Family I set domains 0.026
Further Details:      
 
Domain Number 11 Region: 595-699
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000914
Family I set domains 0.021
Further Details:      
 
Domain Number 12 Region: 1157-1255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000721
Family I set domains 0.026
Further Details:      
 
Domain Number 13 Region: 143-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000107
Family C1 set domains (antibody constant domain-like) 0.071
Further Details:      
 
Domain Number 14 Region: 1523-1622
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000208
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014301   Gene: ENSMODG00000011441   Transcript: ENSMODT00000014565
Sequence length 1706
Comment pep:novel chromosome:BROADO5:1:705733016:705764634:-1 gene:ENSMODG00000011441 transcript:ENSMODT00000014565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILPPPLIPVSPPSFIPSGLGTWKVNSPKDVQGVSGSCLVIPCTFNFPSSVTANQGITSI
WIRDYSDVNKNMVVSHSQDPTKVEKKFQGRAVFLGDPEQRTCNLLLRELSPDDSGQYTFR
FEITGVDSWSAKMFTTVTVTDDPSSPAISSPTDLREDTEVIFNCSTPYVCPEDGSVISWH
GQDPAHSNISQLQVLEPTGVFYHQTLHVALSWRDHGRVLKCQFSGAGKQSQREILLQVHH
APREVEVLLKPSEQNIHLGNSFSLTCHTNSSYPKPTVFRWFKDGLPYSTSQEVLDVSKAT
WEEHGLYSCEVENSMGVGTAAPITVLIFDALIQVHPPGPIQEGQALTLSCTLPGGAQQNV
SYSWFKNNVWMEDWTAQTLVYSRASSAHTGFYFCRVQNSRGATTSPPVNLVVTYPPRVPV
LTSFLETQRGQLAIIHCSVDSEPLANLTLRHGGLVQASSQSQDVPSQRFRVASGHNSLRL
SIQGLEADDGGAYECEAINALGKATSSHDLRADTARVQIQPAAEVVEGKEVTLSCVAAQG
EQPYALYTWYRNGKWLQEGPLSFLTFPKVASTHSGSYHCRAQDSLGILRASPPATLTVLY
PPRQPTDTALVNTEAGGLGLLLCRVDSDPPAELRLLRGTRLVAASQGRSGWGHSHPRIQA
TSGPNSLRVEIRDVVLEDEGEYTCEAANALGNATASVALEAHTTRLLILPSASVKEGGES
NLTCVVAREAKDSSLNFTWYRDGAPWARGSAGAVLLPSVARTDAALYSCRVGTQLGERRS
APVALRVLYPPDPPHLSAFLDTTGGQDAVFLCTVDSSPPASMSLFHFEELVASSLGSRTP
EGRQFHVEASPNSLRMEIKNLKLEDAGNYRCQATNAHGSASTAILFQVHAAWVQASPSLE
VREGQKVSLNCKVTGGAPDGTTYNWYRDSRHLPEPTVSMLHFPSIMAEQGGAYHCQAQAP
GGATSLASPVSLHVSYPPRQPTLTALLDLEAGRSGLIICQVDSDPQAQLRLLRGSQLLAS
SQSRVGIDSSQVTRAFNVLRVEIPDVGLEDEGQYICEASNDLGNATASVAFTVVVRVLPS
LTVQEGQAVNLTCVVSAADVSQLNYTWYRDGHWLGGGPGSSTIFLPNVSAADATSYRCAV
DTPEGGTRLSSPQNLAVLYPPRALRLTSLLDSQAGQPAVLLCTVDSQPPASLALRWAGQL
LASSSPGPARLGASSTPNALRVELQEQKALGAGLYTCSAENSLGQASASLDLQLEVTRVS
IAPAGDVPEGTPVILTCEDPAADPPTIYTWYHNGRWLQEGPTHALQLPGTTRAQDAGTYS
CIARDGRGVRRSQPAALRLLHAPRDVFLTSFLDTRAGRVTVMQCTVDSEPPAELTLSRDG
ELVASGQSPFGSLVGKSRVYTTHNTLRLELWDVSIEDEGDYLCSAQNAFGSISTTGQLWG
EGVRITVEPGLEVHEGDSLNMSCLLAGRAQENATYTWSWNSRWLQEGPEPTLVLSQVASA
QAGVYQCRVDGSLGSASSAPVSLRVLYAPRTPAVTSFLEPETGLWGILHCHVDSEPRSEL
TLSRGGHFIASTRPGSHHGPHIQVLTSYNTLRVDIHEMNSKNQGEYVCLASNALGSASSS
VYFGTRVLSDLHLYRVLFSIFMVLFCCLFLLLGVGAVHLWNRKNLFYKLNANETPMEMSS
QKETPQVASLPSISCQISSCLPQPLS
Download sequence
Identical sequences F6W1M7
13616.ENSMODP00000014301 ENSMODP00000014301 ENSMODP00000014301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]