SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014438 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014438
Domain Number 1 Region: 243-308
Classification Level Classification E-value
Superfamily XPC-binding domain 7.72e-22
Family XPC-binding domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 15-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.77e-21
Family Ubiquitin-related 0.000021
Further Details:      
 
Domain Number 3 Region: 316-376
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000194
Family UBA domain 0.00035
Further Details:      
 
Domain Number 4 Region: 164-219
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000924
Family UBA domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014438   Gene: ENSMODG00000011539   Transcript: ENSMODT00000014704
Sequence length 378
Comment pep:novel chromosome:BROADO5:3:447412298:447417192:-1 gene:ENSMODG00000011539 transcript:ENSMODT00000014704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTEAAAARLGPAMAVTVTLKTLQQQTFKIRMEPGETVKVLKEKIEAEKGRDAFPVSGQKL
IYAGKILSDDVPIRDYKIDEKNFVVVMVTKAKAGPATSVPPEPSAPASANTLEPSTPTPP
APTIVAMPLPPPAPNEEKKATEESAAGTLPEARPGSLPSSGSSGQEDDAASTLVTGSEYE
TMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLMGIPGSPEPESGPVQESQAPEQPAP
EGGENPLEFLRDQPQFQNMRQVIQQNPSLLPALLQQLGQENPQLLQQISRHQEQFIQMLN
EPTGELADMSDVEGEVGAIGEESPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACE
KNENLAANFLLSQNLDDE
Download sequence
Identical sequences F6QX91
ENSMODP00000014438 ENSMODP00000014438 13616.ENSMODP00000014438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]