SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015084 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015084
Domain Number 1 Region: 4748-4962
Classification Level Classification E-value
Superfamily GFP-like 1.05e-59
Family Domain G2 of nidogen-1 0.0017
Further Details:      
 
Domain Number 2 Region: 4372-4461
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-24
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 572-666
Classification Level Classification E-value
Superfamily Immunoglobulin 5.85e-24
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 2917-3015
Classification Level Classification E-value
Superfamily Immunoglobulin 4.32e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 1044-1135
Classification Level Classification E-value
Superfamily Immunoglobulin 2.04e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 3025-3110
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 1307-1405
Classification Level Classification E-value
Superfamily Immunoglobulin 7.99e-22
Family I set domains 0.0091
Further Details:      
 
Domain Number 8 Region: 847-942
Classification Level Classification E-value
Superfamily Immunoglobulin 8.25e-22
Family I set domains 0.0094
Further Details:      
 
Domain Number 9 Region: 4099-4196
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 10 Region: 2053-2147
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-21
Family I set domains 0.0063
Further Details:      
 
Domain Number 11 Region: 1867-1965
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 12 Region: 2437-2522
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 13 Region: 2631-2717
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 14 Region: 3200-3302
Classification Level Classification E-value
Superfamily Immunoglobulin 3.3e-21
Family I set domains 0.009
Further Details:      
 
Domain Number 15 Region: 3310-3396
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-21
Family I set domains 0.021
Further Details:      
 
Domain Number 16 Region: 3665-3761
Classification Level Classification E-value
Superfamily Immunoglobulin 4.08e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 17 Region: 2532-2619
Classification Level Classification E-value
Superfamily Immunoglobulin 5.13e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 18 Region: 1496-1593
Classification Level Classification E-value
Superfamily Immunoglobulin 8.92e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 19 Region: 2836-2923
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-20
Family I set domains 0.0036
Further Details:      
 
Domain Number 20 Region: 1957-2056
Classification Level Classification E-value
Superfamily Immunoglobulin 2.95e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 21 Region: 5-179
Classification Level Classification E-value
Superfamily vWA-like 3e-20
Family Integrin A (or I) domain 0.018
Further Details:      
 
Domain Number 22 Region: 3755-3854
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-20
Family I set domains 0.0091
Further Details:      
 
Domain Number 23 Region: 4293-4380
Classification Level Classification E-value
Superfamily Immunoglobulin 5.06e-20
Family I set domains 0.0079
Further Details:      
 
Domain Number 24 Region: 3392-3487
Classification Level Classification E-value
Superfamily Immunoglobulin 5.16e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 25 Region: 2235-2335
Classification Level Classification E-value
Superfamily Immunoglobulin 5.51e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 26 Region: 2140-2242
Classification Level Classification E-value
Superfamily Immunoglobulin 6.61e-20
Family I set domains 0.033
Further Details:      
 
Domain Number 27 Region: 3942-4032
Classification Level Classification E-value
Superfamily Immunoglobulin 8.41e-20
Family I set domains 0.0055
Further Details:      
 
Domain Number 28 Region: 2341-2429
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 29 Region: 1127-1219
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 30 Region: 750-845
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 31 Region: 4184-4283
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-19
Family I set domains 0.026
Further Details:      
 
Domain Number 32 Region: 662-754
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 33 Region: 1230-1313
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-19
Family I set domains 0.0094
Further Details:      
 
Domain Number 34 Region: 2744-2832
Classification Level Classification E-value
Superfamily Immunoglobulin 2.98e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 35 Region: 482-577
Classification Level Classification E-value
Superfamily Immunoglobulin 5e-19
Family I set domains 0.029
Further Details:      
 
Domain Number 36 Region: 1677-1778
Classification Level Classification E-value
Superfamily Immunoglobulin 7.38e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 37 Region: 3104-3206
Classification Level Classification E-value
Superfamily Immunoglobulin 4.22e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 38 Region: 3476-3575
Classification Level Classification E-value
Superfamily Immunoglobulin 5.75e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 39 Region: 3847-3944
Classification Level Classification E-value
Superfamily Immunoglobulin 6.42e-18
Family I set domains 0.026
Further Details:      
 
Domain Number 40 Region: 936-1034
Classification Level Classification E-value
Superfamily Immunoglobulin 8.06e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 41 Region: 1403-1500
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 42 Region: 3585-3675
Classification Level Classification E-value
Superfamily Immunoglobulin 6.84e-17
Family I set domains 0.035
Further Details:      
 
Domain Number 43 Region: 1586-1687
Classification Level Classification E-value
Superfamily Immunoglobulin 2.6e-16
Family I set domains 0.0092
Further Details:      
 
Domain Number 44 Region: 1776-1871
Classification Level Classification E-value
Superfamily Immunoglobulin 2.96e-16
Family I set domains 0.0087
Further Details:      
 
Domain Number 45 Region: 4969-5071
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000392
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 46 Region: 396-489
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000856
Family I set domains 0.051
Further Details:      
 
Domain Number 47 Region: 5267-5376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000014
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 48 Region: 5133-5215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015084   Gene: ENSMODG00000011793   Transcript: ENSMODT00000015363
Sequence length 5468
Comment pep:novel chromosome:BROADO5:1:456616421:456838020:1 gene:ENSMODG00000011793 transcript:ENSMODT00000015363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDATLAFVFDVTGSMWDDLRQVVEGASRILERSLSGRSKAIANYALVPFHDPDIGPVTLT
SDPAVFQRELRELYVQGGGDCPEMSIGAIKAAVEISNPSSFIYVFSDARAKDYHRKPELL
RLLQLKQSQVVFVLTGDCGDRTHPGYLAYEEIAATSSGQVFHLDKQQVNEVLKWVEEAIQ
VSKVHLLSTDHEKEGEHTWKIPFDPSLKEVTISLSGPGPEIEVRDPLGMILQKDEGLNML
LNIPDSAKVVAFKPEHPGLWSIKVYSSGRHSVRITGISNINFRAGFTTQPSLDLNHTIEW
PLQGVPISLVINSTGLLAPGRLDSVELSHSSGQPLLTLPAGSLSNTSSHQLWVGPPFRVP
KERFYLKVKGEDHEGNPLHRVSNVAYNGVAPGSPLVTMPNKIHGYLWQPLLISCSVHSSL
PFRLQLRRNGVKLGEERHFQESGNSTWEIPRASKSEEGVYECTAMSRAGTGKAKTQLVVT
DPPPQLASPQNVTVSPGETALLSCQVLDKAPYNLTWVRDWRVLPASPGRVVQLANLSLEI
SGIIPSDGGKYQCLASNANGITRASVWLLIREPPQISINTSSRHFSQGVELRISCTASGY
PPPHISWRHNDQTIGMDGRFLVDDQGTLIIQSVTPEDAGNYSCQATNEVGTDEQTVTLFY
TEPPSVSALRPVVLAPIGEEAVLECKASGVPPPRVIWYRGGLEMILAPEVAHTGTLRIQE
VQERDAGNYICKAVNELGAASADIRLEVGYAPRLVESSRNMVVEMGRNAILACRAEGRPS
PRITWARVDGKPVPAHPVEGNRARQLEAGVLFLENVTPEDQALYICEAHNTFGKAQAEVQ
LTVIGHEPPQIASSASMVRVLEGQPASLPCVVLAGKPFPQRHWLKEGQAPLPSSRYSIRT
DGSFHIDRALQEDAGRYSCVVTNTVGSQRQDIELAVQVLPSILPTASHYVTNEGVPISLP
CVSRGIPTPTITWRKETNALSPRSSHHQVLKEGSLYLPQPSAQDSGTYVCTATNALGISS
QEIQLSVNTKPRIIMNESLDSDRPVTITALAGKELTLHCEAEGSPSPLITWTKDSQLLSP
ITDRHSLLPSGSLKLAETSVEDNGLYTCIASNPAGTASRSYVLGVQVPPQIQQGPQLLKV
LAGESLDLTCVATGDPKPQLRWSKDGITLPQKGWVGPDGSVHLESVQVSDSGHYHCVASS
EAGEDARELELEVLEPPRWEAEDAEALLERVAGENASLPCPVTGTPTPRVIWRKDPAPEL
LSSQPGLSVLNDSSLFIASVSSQDSGDYECRATNEVGSVSRKVKLVVYVPPHFRGEEQRV
NVSTLASRPLTLNCDVSGFPTPAITWYKDGRPVSEDNRHYFPDGAPSLHFPQVQKSDSDL
YTCQAVNPAGMAQKDFNLLVLIPPSVRGAGTAQEVSRLAGLEVELECRTSGVPLPQVEWT
KDGQPVAPGDPHIQLVEDGQVLKIPSSHLGDAGHYQCVAFSPAGQQAKDFQLSIQTPPTI
WGSNETGEVAVMEDHVVRLQCDARGVPTPAITWLKDGDPLHASPRVAYAKGGRHLQLGRA
RGSDSGLYTCQASNAAGIAEKAVRLDVYVPPTIEGADGGPLVVKAVAGRPLALGCSASGH
PPPTLTWHQDENPLTENNGTWLQEGGRVLRLERVTEAASGHYSCLANSPAGETVLHYMVE
VQVPPQLLVGEGSGQVTTVKGHSLELPCQATGSPTPIIQWLRNGRPAEEFAGVEVSTDGA
MLRIDHVQPDHNGLFACQATNEAGTAGAEVEVLVHEQPSVTVLEGENITAPFLQPVTIQC
VAAGMPVPNLSWWKNGVSLVTTGGSLQVGFRVPEIEKVDLRDEGNYTCVATNLAGEAKRD
VVLKVLVPPNIEPGLVNKAVLENTSASLECLASGVPTPRISWYRGRQPISSKPGLMVSSD
GRVLRIKRAQLSDAGSYRCVASNVAGSSELKFGLRINVPPRITLAPSLPGPVLLNEPVRL
VCNATGAPTPMLMWLKDGNPVSATGTSGLQIFPGGHVLTLAGSRATDAGTYTCVAVNAVG
EDRRDVTLQVHLPPSILGEEQNVSVVVNQSVTLECQSQAVPPPVLSWRKDGHALSPRPGV
HLSADGVLLQVERAEVQDVGRYTCEALNKAGRSEKHYNLNVWVPPEFSFWEPRTLAVTEG
HPVSLSCECWGIPFPKITWKKDGMLVPTDGGSTEPISAVGRLLYLGKAQPSQEGNYTCEC
SNIAGNSSQEQHLEVYVAPKVPGSSDFHKEVSVIHSGEVTLECEATGKPPPVVTWEKDGQ
LVTRDQGLLLQHRGRALQVEQARAAHAGRYTCIAENEAGRAEQRFDLSVLVPPELTGDTD
PLTNVTTVLQSTLTLLCEVSGNPSPLIRWFRGEEPISPGEDVYFLAGGRILKLTRVQEEE
GGLYMCLASNIVGEVRKNFSVEVLVPPRIENEDTEEVVKVPEGQSAYLTCNVTGNSYPTV
TWFKDGRTLSGGDLYSISPDGSLLEILQANFSSSGHYSCIASNSVSEKTKHYKLSVLVGP
TILGATEDNPDEEVTVTINNPISLICEALAFPSPTVTWMKDGAPFQASGNTQLLPAGTHG
LQILNAQEQDAGRYTCVVTNEVGEAVKNYHVEVLIPPSISKDDPLDEFSVKEVKAKVNST
LSLECESWAMPPPTITWYKDGQLVSPDNRLHLLADGRLLQINPTKAWDSGRYLCVATNVA
GEDDKDFNVLVQVPPIFQKIGDPNEAFEVHHQEEELRGGVLEYREIVENNPAYLYCDTNA
VPPPQLTWYKDDQPLSDIEGISVLQGGRVLQIPMVRSEDAGRYTCKASNEVGEDWLHYEL
LVLTPPVIQGDPEELVEEVTVNANSTVNLQCQALGTPTPVISWLRNGLPFIPSSKHQALE
DGQVLQVSVADAADSASYMCVAENSAGSSEKLFTLKVQAPPRITGLNPERITAIVNSSVS
LPCDVHSHPSPEVTWYKDGWALPFSEDIFLLPGTHTLQLPRPKPSDTGTYTCEALNVAGR
DQKLVLLSVFAPPTIKQTPGGQRDTTVVRVGDTAVLHCESDTLPEPVITWYKNGQQIALD
QQVQTLLDGQKLEIVNVQVADKGLYSCKVSNIVGEAIRTFVLIVQVPPIFENPEKETLSQ
VAGNPLVLVCDVAGVPAPTVTWLKDRMPVALSAESSVERGVVSRGGRLQLSRLQPSQEGT
YTCVAENPEAEARKDFVVMVLVAPRILSSGVPQEHNILEEQEVRLECEAEGQPQPDISWL
KDGRPLGVHTAPHLRRFYTDGSSLVLKGLKSSDSGAYTCLAQNSVGEDTKLHTVSVLVPP
TIERGANGSENLISVQGELVTMACPARGSPPIQINWLKDGLPMPLSQRTHLHSSGRTLRI
SQVQVADAGTFTCVASSPAGVAERTFSLQIHVPPVLEPSETKDAMAVVRGSDVTLPCEAR
GSPLPAVSWLKDGASLMLQRLGLGSGSSLQLEAVQADDVGTYSCVAINEAGEATRHFQLA
VMEPPHIEDSGQAEEMLLLPGAPLELICNALGSPMPNITWQKDGQVLARLGSITKDGRVL
RVEGVQVDDAGLYTCLAENPAGEDGKNFLVRVQAPPNIVGSRETRTVIGLADGQLVLECP
VEADPPPKIEWHREGVLLQADAHTLFLENGRFLQLQALDTSDSGDYNCVASNAAGSTSLP
FSVEIHMAPTIQPGPSVVNVSVNETALLPCKTRGLPVSLVSWRKDGIPLVPGSPRYKLDY
GSLRIQPVYPQDSGYYLCQASNSAGSDRQGRELRVFEPPTIAPGPSNLTLTVHTQATLPC
EARGSPKPHVVWKKNGQTLSLDRHQEAYRLLPSSSLVLTDPDLQDTAQFECLVSNDAGET
RRLFWVTVYVPPTIADDRTDFTVTKMAPVVLTCHTTGVPTPVVSWSKGGAQLGKRGSGYR
VSPTGALEIEQALPIHTGRYTCTARNAAGVAHKHVILMVQASPVINPLPSVVHVMALDDV
VLPCEASGIPRPTITWQKEGLSIPTGGTFILSSGQLRISRASAEDAGNYLCIAKNPSGTA
LGKTRLVVQGIGVVSLNQVSTKKPVFPPNLGEAGVKGQRLSQPPFNSLIRELVPREIPTC
AHPLLAGVGSETTESGGSVPIPPVIKGGHSDLSAAEGSQALLPCIAQGIPEPHITWKKDG
FVVPSMEGKYTIQPSGELLVKNSERRDAGTYTCIAENAAGHTSRRVHLSILSLPTFTTLP
GDLSLNHGDRLWLRCTARGSPTPHISWMVNNRLVKEGVLEQDGGSTLQRAAVTREDSGTY
TCWAENIVGKVQAVSFVHVKEAPALQGEASSHLVELLGDSARLDCAARGDPAPVIRWIKD
GLPVLSSHHKHQLQNGSLAIHRTVMEDAGSYHCLAENEVGVVEKVVTLILRSAPIFVVEP
QDVVVRAGGTVVLLCQAAGEPVPTVEWTHDGHPIRVNQRLRTLPNGSLQFKGVEMDDMGE
YECVAHNLLGTATAHAFVAVKGTSHSEISWGQDLNFHSRILINVLPRQQVQYFSFARALP
FVCTLFQDPFPFWGVVYSCPLTGGTGCGMAKCLLSTLLKGHPARPQLLSSCFLLMKIIAG
SFPLTSFFSWPSPSLVEDVIKGLLRMGIHFINTFDLTLWGGGWFNVLCFVLFLCIRGNWL
LISPEIPWKGRIVSASCPLACHMPSLDSWPTCLRKYSPPVLPDSLAGGLTNQPDPSNRHV
LELLLELVTGMESRESFAMGTLDFLAYRNTSLVDKTMAFYSVPPKHYRFHRTSFCDNTLC
PIFPFFIGDPRGSRGRMVGEINGQEFGVAYLNTSVLQEDDNGATTIQSSINNIPPEVGPL
MRILVVAIAPIYWVLAGQSGEVLNGYSLTKGNFRQESQVEFATGELLHLTQVARGLDRDG
LLLLDVVVNGFIPEALALAQLQVQDFQERYVQIGPGQLYVGSTQTFLKDGAPTHFRCNHT
IQYDSVLGPQPQLVQHLRATEVSSAFDPGEEALRFQLTTALQAGEKNEADCPEGFVLDSL
QAFCTDKDECSSSKSPCSHTCHNSLGRFSCSCPSGYALAWDNRNCKDVDECAWDTSVCHD
GQRCVNLLGSYQCLPHCRTGFQATADGTGCEGDGLLMGNWDKMIAIPLFKEGNRILEMKN
RLMKGGKECQWVEGMEERVRDLISDTHPFLPPDVNECLEHLDECRYNQICENILGGHRCT
CPPGYRSQGHGHPCLDINECLQLPKVCAYQCHNLQGSYRCLCPPGQALLQDGKACGRLEK
IESNVTTISYQGSFPSWLRPRAGAHGGSYHAWISFRPIGSPLSSAGRTWCPPGFTRRNGA
CTDLDECQVRTLCQHACRNTEGSYQCLCPAGYRLLSSGKNCQDINECVEEGIKCGPSQMC
FNTRGSYQCVDTPCPATYRRGSSPGMCFRRCALDCSSGGPFTLQYKLLTLPFGIRADHDV
VRLTAFSDGGVLPNRTVLTVLEPDPNSPFALREPQSGQGAIYTRRPLTDAGVYRLKVQAV
TYGEHRIL
Download sequence
Identical sequences F7ALJ3
ENSMODP00000015084 ENSMODP00000015084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]