SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015610 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015610
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-31
Family V set domains (antibody variable domain-like) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015610   Gene: ENSMODG00000023410   Transcript: ENSMODT00000015899
Sequence length 123
Comment pep:novel chromosome:BROADO5:3:524440965:524441461:1 gene:ENSMODG00000023410 transcript:ENSMODT00000015899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLFFCSGSLSQDVVTQPPSVSAALGSSARLSCTLSSGISGRDVYWHQQSPG
KPPRYLIWVYSDGSTGRADGIPERFSGSGSGTNRFLSISNVQPEDEADYFCQSYYGSGSS
FGY
Download sequence
Identical sequences F6Q482
ENSMODP00000015610 13616.ENSMODP00000015610 ENSMODP00000015610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]