SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015682 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015682
Domain Number 1 Region: 654-816
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.41e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0014
Further Details:      
 
Domain Number 2 Region: 794-911
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.06e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 
Domain Number 3 Region: 79-185
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-21
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015682
Domain Number - Region: 417-467
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0193
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015682   Gene: ENSMODG00000012530   Transcript: ENSMODT00000015972
Sequence length 965
Comment pep:novel chromosome:BROADO5:6:135175996:135244915:1 gene:ENSMODG00000012530 transcript:ENSMODT00000015972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPGSPGGPWLPLAPGAETAPPSTLTLEMETPRESGWPAPDEAPLEPVSGNDPCPVSEKG
AATPEDPEAALYKSGKEVMGENTKLCGYLLKFGGKGPIKGWKSRWFFYDERKCHLYYSRT
AQDVNPLGSIDLSCVTFDCKVEAEEGTFEIKTPSRVITLKAVNKQTMMYWLQQLQLKRWK
FYNSQPGILVSGVTNETSPGNASPLHITLDLDNTETDEFFCPVKTPTGLVGIAAASQPIP
EMPSTLQNISLKHLGTEIQNTMHIICSNRQSRGNGHVSQGDESQKFEENQNEEQHLQADP
GLTGKETEEYSRSTQKSGLTANFIQKAKKQNSSFPIFAEGLREKSFQDKVGVLEQQVMML
SEELKSQKELVKILHKALEAAQQEKRTCSTYLTATEDKDRLELVRHKVRQIAELGKRVES
LQQDKKALEQTLGLREEHIKELEQHVQLLMDKNHAKQQVIFKLTEKVTKDFIDPPTSADG
LESGTFLNPYEKIEHLKDDIEAYRTQNRFLNSEIHQVTKIWRNAAEKEKVLLMKCAYLQA
KNCQIESKYLTVLRKLQDTLPIDDSEYGEMLKKLIHEALQWDVKEGATDSMKFNPVSEYD
DYGFMTVPDYEVEDLKLLAKIQALEIRSNNLLNHEAVEKPLREKWNSIGELMPSADLKHL
IRSGIPPEHRQRVWKWMISLRVKPIQAPNHYDSLLRKCETMEHPAFRQIELDLNRTLTNN
KHFTNPTSKFISKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLILEEEESAFWCLVCIVE
TIMPADYYSKTLIASQVDQRVLQDFLSEKLPRLMAHLGQHKIDLSLITFNWFLVIFVDNL
ISDILLRVWDAFLYEGIKVIFRYALAIFKYNEEAILRIHDSLEIYQYLRFFTKTICNGRK
LMNIAFNDMNPFPMKQLRNRRAVHREKLETELGELEHIKAEFLKERARQESKLLEGCMSE
DEEET
Download sequence
Identical sequences F6PZI4
ENSMODP00000015682 ENSMODP00000015682 XP_007499033.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]