SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016478 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016478
Domain Number 1 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.84e-22
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Domain Number 2 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.55e-22
Family Voltage-gated potassium channels 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016478   Gene: ENSMODG00000013168   Transcript: ENSMODT00000016782
Sequence length 502
Comment pep:novel chromosome:BROADO5:2:280146866:280218507:-1 gene:ENSMODG00000013168 transcript:ENSMODT00000016782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRGPLLTSAIIFYLSIGAAIFEVLEEPHWRTAKDNYARQKIQLLKEFPCLGQEGLDKI
LQVVSDAAGQGVAITGNQTFNNWNWPNAVIFAATVITTIGYGNVAPKTPAGRLFCIFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTAIFIIWGVLVHLVIPPF
VFMVTEEWNYIEGLYYSFITISTIGFGDFVAGVNPDANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSKKSLQMAASGGAKDINIFSFLSKKEET
YNDLIKQIGKKGLKTSGGGGERAVGPESGRAALPPAPVGPLAIYTKTRVPSYEEVSQTLR
LKGHVSRSQSGEAGEGPLGDNTNATTTVFVNQLDRISEEESEAWDARDCRPLIFENANIT
FVNEEGGLSDEDTSKSSLDDNLAGEEGEEQGEGEEAEAEMPLNLGEFPSSDDSTFTSTES
ELSVPYEQLMNEYNKANSPRGT
Download sequence
Identical sequences F6ZM60
13616.ENSMODP00000016478 ENSMODP00000016478 XP_001370230.1.35504 ENSMODP00000016478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]