SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017639 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017639
Domain Number 1 Region: 231-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-34
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 2 Region: 1275-1395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-33
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 3 Region: 931-1037
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1454-1562
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 5 Region: 63-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-32
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 6 Region: 751-871
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-29
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 7 Region: 1619-1738
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 8 Region: 1806-1909
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 583-692
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 410-519
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-25
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 11 Region: 1098-1213
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-21
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 12 Region: 2159-2227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-20
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 13 Region: 2399-2467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-18
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 14 Region: 2216-2285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 2515-2586
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.29e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 2456-2526
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-16
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 17 Region: 2274-2347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 1973-2041
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000243
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 19 Region: 2633-2690
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000417
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 20 Region: 870-934
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000556
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 7-71
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 177-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 2695-2763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000378
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 24 Region: 2331-2392
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 25 Region: 2577-2638
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000621
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 26 Region: 1220-1283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000959
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 27 Region: 2100-2163
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000973
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 28 Region: 695-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000133
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 29 Region: 1566-1635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 1911-1984
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 31 Region: 352-412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 32 Region: 1044-1108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 33 Region: 1394-1457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 34 Region: 525-587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000337
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 35 Region: 1737-1801
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000567
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 36 Region: 2754-2811
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000612
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 37 Region: 2053-2111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000236
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017639   Gene: ENSMODG00000014053   Transcript: ENSMODT00000017967
Sequence length 3044
Comment pep:novel chromosome:BROADO5:1:552004539:552615667:-1 gene:ENSMODG00000014053 transcript:ENSMODT00000017967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIDKGGCGDPGIPSYGKRTGNSFLHGDTLTFECQAAFELVGERVITCQQNNQWSGNKPSC
VFSCFFNFTTPSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAV
KDDGMSDVSVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDP
GIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCIMQDGNVVWSSTVPRCEAPCGG
HLTASSGVILPPGWPGYYKDSLNCEWVIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPAN
SSPLIGEYHGTQAPQFLISTGNYMYLLFTTDNSRSSVGFLIHYESVTLESDSCLDPGIPV
NGHRHGNNFGIRSTVTFNCDPGYTLSDEEPLVCERNHQWNHALPSCDALCGGYIHGKSGT
VLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGSFTEPVARLT
GSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRRIGFH
FGVGDSLTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVTGNEGTLLSPNF
PSNYDNNHECIYKIETEAGKGIHLRARSFQLHEGDVLKVFDGKNSASRPLGAFSKNELMG
LILNSTSNHLWMEFNTNGSNTDQGFQLTYTSFDLVKCEDPGIPNYGYKIRDEGHFTDTIV
QYSCNPGYAMHGSSTMTCLSGDRRVWDKSLPSCIAECGGRIHAATSGRILSPGYPAPYDN
NLHCTWIIEADPGKTISLHFIVFDTEMAHDILKVWDGPIDSNIFLKEWSGSALPEDIHST
FNSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGMPQNGTRYGDSREPGDTITFQCDPG
YQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWR
IKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPERIESSGNSLFLA
FRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDSGYKIIDPS
SITCEIGVDGKPAWNRILPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQMCHYSITVPKE
FVVFGQFAYFQTALNDLAELFDGAHPQARLLSSLSGFHSGETLPLATSNQILLRFSAKSG
ASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSKAIR
CQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGI
QIQVISFATEQNWDSLEIYDGADMTAPRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAA
AGFHLEYKTVGLAACQEPVLPSNGIKIGDRYMVNDVLYFQCEPGYTLQGRSHISCMPGTV
RRWNYPSPLCIAKCGGTLNSMTGVILSPGFPGAYPNNLDCTWKISLPIGYGAHIQFMNFS
TEANHDYLEIQNGPFHTSPMIGQFSGTDIPSALLSTTHETLIHFYSDHSQNRQGFKLAYQ
AYELQNCPDPPPFQNGYMVNSDYSVGQSISFECYPGYVLIGHPVLTCQHGINRNWNYPFP
RCDAPCGYNVTSQNGTVYSPGFPDEYPILKDCIWLITVPQGHGVYINFTLLQTEAVNDYI
AVWDGPDQNSPQLGIFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFHAYQLKKCQS
PPAVPQAEILTEDNDFEIGDFVKYQCLPGYTLSGTDILTCKLSAQLQFEGSPPTCEAQCP
ANEVRTESSGVILSPGYPGNYFNSQTCSWTIKVEVGYNITVFVETFQSEKQFDVLEIFDG
SSGQSPLLVLLSGNHTEQSNYTSKSHQLYFRWSTDHATSKKGFKIRYSAPYCSLTQTLKN
GGIVNRTRGPVGSRVHYFCKPGHRMIGHSNATCRRNPNGLYQWDSLTPLCQAVSCGIPES
PGNGSFMGNEFTLDSKVNYECNEGFRLESSQQGTATCQEDGLWSNKGKPPTCKPMTCPSI
ETQLSEHVIWRLVSGSVNEYGAQVVLSCSPGFYLDGQRLIQCQANGTWSIRDERPSCKVI
SCGGLSFPPNGNKIGTLTIYGATAIFTCNTGYTLVGSHVRECLANGLWSGMETRCLAGHC
GSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGH
PGNPAHGLTNGSEFNLNDVVNFTCSTGYLLQGAARAQCRSNGQWSSPLPTCRVVNCSDPG
FVENAIRHGQQNYLESFKYGISVMYHCKKGFYLLGSSALTCKANGLWDRSLPKCLPISCG
HPGIPANAILTGEQFTYGSIIHYSCTVSRTLMGNATRICQEDSHWSGTLPHCSGNSPGFC
DDPGTPAHGSRLGEEFKVKSLLRFSCEMGYQLRGSPERTCLFNGSWSGVQPVCEAVSCGN
PGTPANGMIINSDGILFSSSVIYACWEGYKTSGLTTRHCTANGTWTGTAPDCTVISCGDP
GTLANGIQFGNDFTFNKTVSYQCNPGYLMEPASASTIQCTKESTWNQSKPVCKAVMCGQP
PQVQYGKVEGTDYHWGASISYSCAEGYQLSNSAILSCEGRGVWRGDVPQCLPVFCGDPGT
PAEGRISGKSFIYRSEVSFQCKSPFILIGSSRRLCQADGTWSGIQPTCIDPAHNTCTDPG
TPHFGMQNSSRGYEVGSTVFFRCRKGYHIQGSTTRSCLANLTWSGIQTECIPHACRQPET
PAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKPDMKWTGKSPVCKSKGVREVNE
TVTKTPVPSDVFFINSVWKGYYEYLGKRHPATLTVDWFNATSSKVNATFIEGSNMELKLS
GVYKKEEAHLLLKVFQIKGPVDIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFG
KFKLERQGPLSIDPDSSNHYYGTNSSSVAAAILVPFFALILSGFAFYLYKHRTRPKVQYN
GYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences F6QIU1
13616.ENSMODP00000017639 ENSMODP00000017639 ENSMODP00000017639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]