SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017715 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017715
Domain Number 1 Region: 707-908
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-39
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 2 Region: 507-699
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-37
Family Fibronectin type III 0.0009
Further Details:      
 
Domain Number 3 Region: 376-478
Classification Level Classification E-value
Superfamily Fibronectin type III 4.62e-24
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 4 Region: 1348-1435
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 149-244
Classification Level Classification E-value
Superfamily Immunoglobulin 8.01e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 277-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000318
Family I set domains 0.016
Further Details:      
 
Domain Number 7 Region: 927-991
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000484
Family V set domains (antibody variable domain-like) 0.074
Further Details:      
 
Domain Number 8 Region: 1125-1210
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000441
Family I set domains 0.024
Further Details:      
 
Domain Number 9 Region: 1242-1306
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000613
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017715
Domain Number - Region: 1025-1100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000307
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017715   Gene: ENSMODG00000014165   Transcript: ENSMODT00000018043
Sequence length 1461
Comment pep:novel chromosome:BROADO5:1:549583344:549733372:1 gene:ENSMODG00000014165 transcript:ENSMODT00000018043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSLPFYQKRHKHFDQSYRNIQTRYLLEEYAAKKRAQSQSSSTQKSSSQKASSKTSIG
GTTCRLCEKRLNTSSEEEELESKRRSQSLLSSYGEARRQRFLNELSFIEEDVRLARSLAR
EKLDKYSIQEMVQDKMAWERHAFEERISRAPEILVRLRSHTVWEKMNVKLCFTVQGFPTP
VVQWYKNDSLICQAGEPGKYRIESKYGVHTLEINRADFDDTATYSAVATNVHGQVSTNAA
VVVRRFRGEEEPYHSVGLPIGLPLSSIIPYTHFDVQFLEKFGVTFKREGETVTLKCSLVV
TPDLKRLQPRVEWYRDSELLKESKWTKMFFGEGQASLSFGHLNKDDEGLYTLRIISRGGV
TDHSAFMFVRDADPLVTGAPGAPMDVKCHDANRDYVIVTWKPPNTASESPVIGYFIDRCE
VGTDNWIQCNDSPVKICKYPVSGLFEGRSYMFRVRAINNAGISRPSRVSEAVAALDPVDL
KRLQAIHLEGNREIVIYQDDLEGDVQIPGPPTNVHASEISKTYVVLSWDPPVPRGKEPLM
YFIEKSMVGSGSWQRVNSQTAVRSPRYAVFDLAEGKPYVFRVLTANKHGLSDPSEITAPI
QAQDVIVAPSAPGRVLASRNTKTSVVVQWDKPKHEEDLIGYYIDCCVAGSNKWEPCNHKP
IDYNRFVVHGLTTGEQYIFRVKAVNAVGTSENSQESDVIKVQAALTAPSYPYGITLLNCD
GHSMTLGWKVPKFSGGSPILGYYIDKREAHHQNWHEVNSSPIKERIFTVENLTEQAFYEF
KIAATNLAGIGQSSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVILWKAPVYSGSGP
ITGYFVDYKEEGSEEWITVNESTTKNRYLKVTDLQQGKTYVFQVRAVNASGVGKPSDTSE
AVLVEARPGTKEISAGVDEDGNIYLSFDCPEVTDASHFTWCKSYEEINEPEKFNIETEGD
HSKLYFKNPEKSDIGTYSVSVSDTDGISSSFVMDEEELERLMALSNEIKNPTIPLKSELA
YEIFDKGQVRFWLQAEHLSPDASYRFIINDREVSDSETHRIKCDKSTGIIEMVMDRFTIE
NEGTYTVQIHDGKAKNQSSLVLIGDAFKAVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEE
CEVRLKCKVANTKKETVFKWLKDDVLYEVEALPDLEKGLCELLIPKLSKKDQGEYKATLK
DDRGQDASVLEIAGKVYDDMILAMSRVCGASASPLKILCTPEGIRLQCFMKYFTEEMKVN
WYHKDAKISSSEHMRIGGSEEMAWMQICEPTEKDKGKYTFEIFDGKDNHQRTLDLSGQAF
DEAFAEFQQLKAAAFAEKNRGKVIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVVWFKNDK
DIELNEHFVVKVEQSKYVSLSIKGVTSEDSGKYSINVKNKYGGEKIDVTVSVYKHGEQIP
DVSPPQAAKPKLIPASSSTLE
Download sequence
Identical sequences F6U7N1
13616.ENSMODP00000017715 XP_001381506.1.35504 XP_007476288.1.35504 ENSMODP00000017715 ENSMODP00000017715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]