SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017746 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017746
Domain Number 1 Region: 369-585
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-54
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 878-1113
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000115
Family Cell cycle arrest protein BUB3 0.081
Further Details:      
 
Domain Number 3 Region: 615-675,769-824
Classification Level Classification E-value
Superfamily PH domain-like 0.000000354
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017746   Gene: ENSMODG00000014194   Transcript: ENSMODT00000018074
Sequence length 1332
Comment pep:novel chromosome:BROADO5:1:549254039:549421925:1 gene:ENSMODG00000014194 transcript:ENSMODT00000018074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENEFKSATNNNEEEEEQFDFDSGDEIPEADRQAHLPSSESDSKGFSFLEDGNETGGDNSQ
AAEAGKLPVHMKVNPYSVINITPFQEKEQLSPDPGAEEENSSSSVPSVYSVPVPCGYAVP
SNLPLILPAYSSPIIIRTLSVDEEDTQEVTEESHFNSLSSEDPPNSEDQVNKEDSPLAKW
VADPANTAWMENPEEVIYDDVPRENSDSEPEEMIYDDVENGDEGGNSSLDYGWSSSEFES
YEEQSDSECKNGIPSSFLRGNHKKQLSHDLTRLKEHYEKKMKDLMANTVGAVEIQQLKQK
HELKMQKLMRAAKEGTKDGLEKTKAAVKKGRSFIRTKSFVSNEHRSCLQEEELNLFIDVD
CVHTEAIMTPMPEGLSQQQVVRRYILGSVVESEKNYVDALKRILEQYEKPLSEMEPKVLS
ERKLKMVFYRIKEILQCHSMFQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVN
NFSTAVGILKKTCATKPAFLEFLKQCQESSPDRITLYGLMMKPIQRFPQFILLLQDMLKN
TTKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKQIAKAINERYLNKLLSSGNRY
LVRSDDMVETVYNDRGEIVKTKERRLFMLNDVLMCATVSARTSHESSGAVSTSQRYLLKW
SVPLGHVEVIEYSSGQGQGENSRYPQAHSTESIIVVANAKPHKLYMGPGQLYHDLQNLLH
DLNVVGQISQLIGNLKGNYQNLNQSVAHDWTSGLQKLIMKKEDEIRAADCCRIQLQLPGK
QDKSGRPTFFTAVFNTFTPVIKQSWINNLQMAKLALEEENHLGWFCVEDDGNQIKKEKHP
LLVKHMPVMVAKQQEFKIECAAYNPEPYLGNETEPDSFSMQHGFLWIGSCTNQMGQIAII
SFQHSSPKVIECFNVESRILCMVYIPVDEKHKESKVTSDSETVVGKTSDVPTICLGTEEG
SISIYKSSQGSKKVRLQHFFTPEKSTVMSLTCTSQYLYAGLVNGNVVVYTKTEDGSWNSE
PQKVVKLSVLPVRSLLMMEDTIWAASGGQVFIINIETHSIENHLEAHQEEGMVISHMAVA
GVGIWIAFTSGSTLRLFHTETLKHLQDINIATPIHHMMSGQQRVSVTSLLVCHGLLMVGT
NLGIIVSLPVPRLQGIPKVTGRGMVSYHAHNGPVKFLVTATALNRKNNSHSRNSLLPNAE
AQDEEQKDLLPNELPGSCLNQSTPDSAVWLGDSVGSIPPKSDLSSSSGSLTLSHGSNSLE
HGPEDSTIYELLKDPNIALKGKSHQFKKSKASSVLVICGGQGHRRVNKKAKQQRQDELGS
SVMVWQIPLLNI
Download sequence
Identical sequences F6TRD9
ENSMODP00000017746 13616.ENSMODP00000017746 ENSMODP00000017746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]