SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017978 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017978
Domain Number 1 Region: 1509-1593
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-17
Family I set domains 0.0039
Further Details:      
 
Domain Number 2 Region: 1606-1680
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000128
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 1392-1464
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000417
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 951-1015,1060-1105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000492
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 429-505
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000071
Family I set domains 0.033
Further Details:      
 
Domain Number 6 Region: 338-425
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000183
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 1208-1283
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000309
Family I set domains 0.0098
Further Details:      
 
Domain Number 8 Region: 693-778
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000492
Family I set domains 0.013
Further Details:      
 
Domain Number 9 Region: 612-671
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000129
Family I set domains 0.029
Further Details:      
 
Domain Number 10 Region: 515-602
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000015
Family I set domains 0.014
Further Details:      
 
Domain Number 11 Region: 1303-1390
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000505
Family I set domains 0.011
Further Details:      
 
Domain Number 12 Region: 1127-1214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000508
Family I set domains 0.011
Further Details:      
 
Domain Number 13 Region: 783-859
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000729
Family I set domains 0.018
Further Details:      
 
Domain Number 14 Region: 224-314
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000558
Family I set domains 0.09
Further Details:      
 
Domain Number 15 Region: 869-943
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000721
Family I set domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017978   Gene: ENSMODG00000023866   Transcript: ENSMODT00000018309
Sequence length 1733
Comment pep:novel chromosome:BROADO5:4:368816003:369162905:1 gene:ENSMODG00000023866 transcript:ENSMODT00000018309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGLLAAQTQKQNINRQQSPSPSHSGSRSQSQSPSPIVSPSPSPPRTPKGTAHCSSHHSS
SHAQPHTHSHHLHNTNHHPSNTCPTRRKATGLAKRKAKKGRSPYGREKRADRRAPVLKRK
IPVLWSRGSSLHRDRDRLWSSHTVVSLESSRDSSRETPKDETPYWVGEQRFLGRREAVTP
DEQCRPMERPSKASQSRGSSWKGLLIITATILSCWIQPTSAQDITVEVEPPLGTQGLSVT
FRIVGYSGTPVMYNWYYKTSAQQPSRKHIVTYSTYNRRQLQTKIRQRVYHNGTMFFPNLL
VSDSGYYEVQIIKDRFTLDRPEAGAPLKVYVALSKPTIVTSNNTAVETKDISLTCQATGD
IHSTKWYINQRAPSGSRIQLTPDKRTLTIRNLTRTENKGPYVCEMKNPVSSGRSDPFTLN
VAYGPDSAKILPAADRYNVGDRIQLTCSAQSSNPPVQFTWLQNGQPVSNSAKFSATAALN
HAGNYTCVAYNSLTGITRTKSMNIIIYGPLSKPTILTSNNTAVETKDFSFTCQPTGAIVT
TRWFINGVAPAGGRIQLSPDKRTLTIRRLTRRENKGPYVCETENPVSLSRSDPFTLNVAY
GPDGATIIQTPDVYPIGIRVNFSCSAPSNPHSQFTWFYNGRFLSNASAMFVTATLRHTGN
YTCIASNSVTGLVRNQTKIITIYAPLSKPAILISNKTAVESKDFSMTCKAKGQINTYQWF
INGLAPADSRIQLSRDKRTLTIRRLTRRENKGPYVCEIQNPLFRNRSDPFTLNVAYGPDG
ATIIQTPDVYPIGIRVNFSCSAPSNPRSQFTWLYNGRFFSNTSAVFVTAALRHTGNYTCI
ASNSVTGLVRNQTKIITIYAPLSKPTILTSNNTAVETKDFSLTCNGTGQIHAYQWLINGL
APADSRIQLSPDKRTLTIRRLTRRENKGPYVCEIQNPLSRNRSDPFTQYVAYGPDIATIV
QTPDVYPTGANITFSCSAKSNPSSQFTWLHNGQIFSNAASTYVTATLMHTGTYTCKASNS
FTGLMHTQTKNITIYDGPDTAMIVRTPDVYPTGANITFSCSAQSNPPSQFTWLHNGQRVS
NSATFSIIASLNHAGSHICIASNSFTGLMLTQTKNITIYAQLSKPTILTSNNTAVETKDF
SLTCNGTGQIHAYQWLINGLAPADSRIQLSPDKRTLTIRRLTRRENKGPYVCEIQNPLSR
NRSDPFTLDVAYGPDTAMIVRTPDEYPTGANITFSCSAQSNPPSQFTWLHNGQHVSNSAT
FSIIASLNHAGSHTCIASNSFTGLMHTQTKNITIYAQLSKPTILTSNNTAVETKDFSLTC
NGTGQIHAYQWLINGLAPADSRIQLSPDKRTLTIRRLTRRENKGPYVCEIQNPLSRNRSD
PFTLDVAYGPDTPRIIPTVDQYPVGANIMLICSAKSKPPAQFTWFHNRKKLRHSAKLSIT
NVSLNHAGTYICHASNSYTGLNSTKHKTLTIYAKEKNTTLSAEDKNLTINAEFTIYENLM
KHNKTINSTSFVIENGTAVLTCNTEDEDLPDIWWYFNNKRLILNDRMTLSEYGQTLTIMP
VKREDSGAYRCEMWNPFLVHTSNSFNLVVSYGPEEIKILPKHVHGQIEVLLKKKLILECW
ANSQPPAQYIWQVNGSSISGNSGNTYTISQASWEHAGTYTCVAMNKVANTTISTKITVKV
IEASGGSSLSGGTITVIVAGVVGGVVLIGALIYFQFILEPAGEVLDETHLNYQ
Download sequence
Identical sequences F7CWC2
ENSMODP00000026705 ENSMODP00000017978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]