SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018269 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018269
Domain Number 1 Region: 29-208
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.13e-68
Family MHC antigen-recognition domain 0.00000206
Further Details:      
 
Domain Number 2 Region: 213-302
Classification Level Classification E-value
Superfamily Immunoglobulin 3.75e-28
Family C1 set domains (antibody constant domain-like) 0.0000782
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018269
Domain Number - Region: 274-354
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0639
Family C1 set domains (antibody constant domain-like) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018269   Gene: ENSMODG00000014624   Transcript: ENSMODT00000018602
Sequence length 369
Comment pep:known chromosome:BROADO5:2:269512870:269556412:-1 gene:ENSMODG00000014624 transcript:ENSMODT00000018602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLTMEFFVLSLLLLGTLILTETWAGKCFHSLKYFYTTMSLPELIEPRFTAVVYVDDQQIL
SFDSDSASQSMEPRTQWIKVEPPDYWERVTRISREDSQCNRMCLQKVSTNYNHSEGGVHT
YQRQAGCEVFSNGSFSRGFAQYGFDGRDYLTLDTGTLRWVAADAGALNNKRKWEADQRIA
ENWKIYLEGECVHSLQRYLENGKERLLRADPPSARVTRHTSSDGEVTLKCRAQDFYPAEI
SLVWLREGEEQLQDTEFIETRPAGDGTFQKWAAVEMLSGSEHKYTCRVQHEGLPEPLFLK
WGKDGESQFSSIGLSAGVITILLLLAAVIIGVVVWRKNTSGREEGSYTATASNDSAQGSD
VSFTARSKI
Download sequence
Identical sequences F6YQF2
ENSMODP00000018269 ENSMODP00000018269 13616.ENSMODP00000018269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]