SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018354 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018354
Domain Number 1 Region: 1288-1380
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-19
Family I set domains 0.0076
Further Details:      
 
Domain Number 2 Region: 1199-1274
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 1397-1481
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000534
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 887-951
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000172
Family I set domains 0.055
Further Details:      
 
Domain Number 5 Region: 661-728
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 1542-1609
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 432-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000127
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 788-849
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 377-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 10 Region: 529-583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 11 Region: 33-81
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 12 Region: 728-788
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 13 Region: 296-359
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 14 Region: 610-666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 15 Region: 1670-1727
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000445
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018354
Domain Number - Region: 1488-1547
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000235
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number - Region: 1609-1668
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000288
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018354   Gene: ENSMODG00000014683   Transcript: ENSMODT00000018687
Sequence length 1764
Comment pep:novel chromosome:BROADO5:6:183223504:183608319:1 gene:ENSMODG00000014683 transcript:ENSMODT00000018687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCRWATPGTPLLFLAFLLLSSRTARSEEDRDALWDAWGPWSECSRTCGGGASYSLRRC
LSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKYHGQLYEWLPVSNDPDNPCS
LKCQAKGTALVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNG
DGSTCRLVRGQYKSQLSATKLDDTVVAIPYGSRHVRLVLKGPDHLYLETKTLQGAKGENS
LSTTGSFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKVHNAGTADSTVQFIFYQPIIHR
WRETDFFPCSATCGGGYQLTSAECYDLRSSRVVADQYCHYYPENVKPKPKLQECNLDPCP
ASDGYKQIMPYDLYHPLPRWESTPWTACSSSCGGGIQSRTVSCVEEDIQGHVSSVEEWKC
MYTPKMPIVQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKP
HIKEECIIPTPCYKPKEKLPVEAKLPWHKQAQELEEGAVVSEEPSFIPEAWSACTVTCGV
GTQVRMVKCQVLLSFSQSVADLPVDECEGPKPVSQRACYAGPCNGEISEYNPEETDLLYG
GLQDFDELFDWEYEGFTECSESCGGGVQEAVVSCLNKQTRETADESLCVTSRRPPKLLKS
CNLDPCPSRWEIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVVLADELCHKPKPTIV
QACNRFNCPPAWYPAEWQQCSRTCGGGAQKRDVLCKQRMADGSFLELPETFCSAPRPTSQ
QACRNEDCPHEWLLSEWTQCSRSCGEGTQTRSAICRKILKSGESVIVNSSLCAPLPFSSS
VQPCILPACAGPSRPSPKHSPHITAVRKIYIQIQKQRKLHFVVGGFAYLLPKTSVVLRCP
TRRFRKPLITWEKDGQHLTSSAHITVAPFGYLKIHRLKPSDMGTYTCSAGPAQEHFVIKL
IGSNRKLLARPLGLRGEEETPPGRKNSPNEALRTQEKHQNGIFFNGSKAEKRVPPVDPGS
RYDDIVSRLLEQRGWPGELFASWEAQDSTERNISSEEDQNPEQALLHLPFTLVTEQQRLD
DLLRNISQQPEELRDLYSKHLVSQLAREIFRSHLEHQDSLLKFPEGRIHPVAIPPHKHVS
GFSSSLRISSLGSSGEMRSGQPHRKPVILRKISAAQQLSASEVVTHLGQTVALASGTLSV
LLHCEAGGNPKPTITWARNGEEVQYSNRILLQPDDSLQILAPVEADVGFYTCNATNALGS
DSVSIAVTLAGKPLVKTSRMAVTNIDLPAVIVDVGSVIKTIPGVNVTISCQVAGVPEVEV
TWFRNKSKLAPLHHLHDGSLWITNVSFSDQGLYSCRAVNLHGEVTENTQLEILDPPHPPS
QMEDIKALLSANGPNLPSVLTSPLGTQLVLSPGNSAILGCPVKGHPYPNITWFHDHQPIA
TIAEPTYHILAAGQILLIRNVSAGSQGEFSCLAQNEAGMLVQKTSLVIQEYWWSVDKLVG
CSASCGNKGIQQPQLKCVLNSTEVSPSFCAGKAKPAVQPVACNRRDCPSRWMVTPWSSCT
RSCGGGVQTRRVTCQKLKASGASVPMSNEMCSQLAKRPVDTQACNQQLCVEWAFSSWGQC
NGPCIGPRLAVQHRQVFCQTRDGISLPFEQCSALPRPVSTQNCWAEACGVHWRVSLWTLC
TATCGNYGFQSRRVDCIHIRTNKPVPEHLCSWRPRPANWQRCNITPCENMECRDTTRYCE
KVKQLKLCQLTQFKSRCCGTCGKA
Download sequence
Identical sequences F7DNN9
ENSMODP00000018354 ENSMODP00000018354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]