SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018870 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018870
Domain Number 1 Region: 464-619
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.88e-28
Family Toll/Interleukin receptor TIR domain 0.00054
Further Details:      
 
Domain Number 2 Region: 326-416
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000206
Family I set domains 0.062
Further Details:      
 
Domain Number 3 Region: 31-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000243
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018870
Domain Number - Region: 144-183,252-309
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000388
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018870   Gene: ENSMODG00000015095   Transcript: ENSMODT00000019210
Sequence length 639
Comment pep:novel chromosome:BROADO5:7:256647549:256793891:-1 gene:ENSMODG00000015095 transcript:ENSMODT00000019210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLWFPILFLLSGTPQSSASERCDDWGLDPMRQIQVYEGEPAHIQCPLFEHFLKFNYST
AHSAGLTLIWYWTGQDQDLEEPINFRLPDNRISKEKDLIWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVIQKSSCFSSRMKVPREYMYMEHTLQSLRCPNIEGFFPSSVQPKVVWYMS
TCHREAKANVLKHTTNIPTGSGTQINSRLRSRTQSYTDSKSQDSDAALRTPNPTSHPPSS
SRDGETEIPICEVVNNYYKVDVNGPELIFTYVLTSNSANYTCVVTYPENGRMFNLTRTVE
VKVVASPIYATAPDIFSPNDHITYDKEPGEELELPCKVRFPFLKDSRDEIWWTVDGRKPD
ETMNITINQSETVEIVGDKTITRILSIKKVTSDDLKRNYTCHARNDKGESVKQAIVKQIV
VPPRYTVELACGFAVTIVLIIILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSY
ARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPN
YILQGTQSLLELKAGLESMASRGSVQVILVQYKAVKETKVKELKRAQTALTVIKWKGEKS
KYPQGRFWKQLQVAMPVKKRPSWSSTEEHGLSYSSLKNV
Download sequence
Identical sequences F7F3A2
ENSMODP00000018870 ENSMODP00000018870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]