SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019671 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019671
Domain Number 1 Region: 142-266
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.19e-24
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 7-34,74-142
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-23
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019671   Gene: ENSMODG00000015769   Transcript: ENSMODT00000020025
Sequence length 386
Comment pep:novel chromosome:BROADO5:1:507723954:507782314:1 gene:ENSMODG00000015769 transcript:ENSMODT00000020025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPETTDRQRLERKQLELRARYNLSQGGYE
ELERVVLLLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTFVKYLLHRAKKGLGMRRSDVSMANMVIIGFFSCISTLCIGAAAFSY
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGSILTTDTASSTIAGSGGFRNVYAEVLHF
QSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSQSSPGGGRYIETPSHRCLCTAQR
SAISSVSTGLHSLSTFRGLMKRRSSV
Download sequence
Identical sequences F6ZSC2
ENSMODP00000019671 XP_001370966.1.35504 ENSMODP00000019671 13616.ENSMODP00000019671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]