SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019713 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019713
Domain Number 1 Region: 108-188
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000028
Family V set domains (antibody variable domain-like) 0.076
Further Details:      
 
Domain Number 2 Region: 649-908
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000458
Family Rhodopsin-like 0.018
Further Details:      
 
Domain Number 3 Region: 302-341
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000628
Family Hormone receptor domain 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019713
Domain Number - Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0787
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019713   Gene: ENSMODG00000015803   Transcript: ENSMODT00000020067
Sequence length 917
Comment pep:novel chromosome:BROADO5:1:507127339:507138621:-1 gene:ENSMODG00000015803 transcript:ENSMODT00000020067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETTPFTAYVQMEVLEKSWSWSFFSNSTLPQSLRYLTDLSITTECVENHNGSFNCECLPGH
GWNASTCYHHKPCRDSNFFHSYTCIIFHHPDIGYCQLLPPVPGNLSLHSALPSPGSTLTL
TVLLSHEATHLGWYLQPVGSQTSVKLQPGTQVFLGDQKSQSVLTIANVSRDWAGQYVCRF
MSRGFQWLLHQVVEVPLQANDVIRHPSQLSISCNAFSGFELRCCIPNTNRTYTASWSPRN
LSSTTALSSRTSGTQCLTLVVPRCPENDTKYTCKLQSPGLDPVSISISVSIIRDGDTTCP
QDSLGGDWNVTKAGHIAQIPCPLNTVGTVERHCGTKGTWGPINSSCTDERLVTMFHTAQL
LLAGQGQPRKKVPKLMTQLRKHVAAVSSPSDLLALLGTVNILAQVVTRARTELPRETLKD
FLVATNDLLELDPNSIWAPAQAQVPSVSSAILQAVESLGRSLCSNDHPFSLTLSNVQLQT
QLLGPKTPEDYSISFSTHPPLRVQIPHHALAQLDWETGNISITSMVLRKLGHILPRNFGQ
ELEDLLYETPDLVLSNSIKDGNQTVTKGEIIMDFGGTRGTPTCVFWNHNLFQGAGAWSKE
GCEARVIDTSSTTRCVCLHLTSFSILMSLHSVPDNPALTLMTQVGLGASILALLLCLGVY
RVVWSAVIRNKISYFRHVALLNVVLCLLTADTFFLGESLLSLSPHSPLCLAVTFLCHFFY
LATFFWMLAQALILAHQLLFIFHHLSKHRVLPIMFILGYLCPLGFAGATLGLYLPQGQYL
QKDQCWLDGKGGARYTFVGPVIIIVGVNGLVLAMAVVKLLRPSLSEGPQTEKRQALLGVI
KALLILMPIFGLTWMLGLATLMDGGNEVPHYLFTVLNTSQGIFILLFGCLMDKKVREALH
KRLCCILPAASTVSLVS
Download sequence
Identical sequences F7FRZ2
ENSMODP00000019713 ENSMODP00000019713 13616.ENSMODP00000019713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]