SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020937 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020937
Domain Number 1 Region: 109-319
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-61
Family DBL homology domain (DH-domain) 0.0000234
Further Details:      
 
Domain Number 2 Region: 304-447
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-31
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020937   Gene: ENSMODG00000016771   Transcript: ENSMODT00000021306
Sequence length 1417
Comment pep:novel chromosome:BROADO5:2:430507559:430620051:1 gene:ENSMODG00000016771 transcript:ENSMODT00000021306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDSDRPVSFSSTSSSASSRDSHCSFGSRLTLASNGHLSLCNNQDKETGAIKLELMPT
RRFSSSEVQRNPPEEKQNMEESSENWQGVLRTPETKGANKNGTLSLVAESTTSPKLLYVD
RVVQEILETERTYVQDLKSIVKDYLDCIKDQSKLSLGAEERSALFGNIQDIYHFNSGLLQ
DLENCENDPVAIAECFVSKSEDFHIYTQYCTNYPRSVAVLTECMRNKMLAKFFRERQETL
HHSLPLGSYLLKPVQRILKYHLLLHEIENHLDKETDGYDVVLEAIDTMQRVAWHINDMKR
KHEHAIRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKRE
ETFTYKAHILCGNLMLVEMIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWILHLKRLI
LENHAAKIPAKAKQAILEMDAIHHPGFYYSPEKEIKTFSSSKEGTAPHRLRRKSEPSSRV
HKVLKASETTQDIQKVNDEEASPSLITDLPRSTSAGNPPTQRTSQQNNPVILNVLGGAGA
GVRNIWTDHQIRQALFPSRRSPQENEDDEDDYQMFMPSLSSSDLHSTRLCEESNGSSRPC
SWHLGQMQSRDPGITSSGHRIVRRASSAGESNTCVPEARNRDSEDIQHSSRREVDRGSRT
ESDGKAYFDPELTLQDVDHVYDNISYEDLKRMGFAKRDTPEYIPQRSNMDSFQGLHHQSS
PNLLISPQKQESQDNLTIPEKRDGTLSSRDPSNLSSNELNIAEENIYDTIQLPDPPLLNF
KCNYLKCAKRSSFLGLETDFACCDSLRPFVSEESLQFSEDETPYRQAPVENDYLSLLYSS
SNSDSLSHKSVADKLSEEVDEIWNDLENYIKKNEDKTRDRLLAAFPVSKDDVQERLHAGS
TPELSKDINYAISTLSLPENPAFLKPVKNKAMRLSRTHLPFEEDMLYKENSLMNLNRLSL
ASEMPSIESPCDSINSSLSHTDPESTDPRVSSTDKTKSRVFLMARQYSQKIKKANQLLKV
KGPEGEQTASQPHKSRHKDLAAILEEKKQGGPAIGARIAEYSQLYDQIVFRGTPLKTRKD
GWASPGGSPILRSSSPPSMSLSHSQFDDESSQTEDWLLHSTYSNGELADFCVWPHEDTKS
RYSHSEMNVKSTPRQLPTVCSVPLLQTSTPLQGPAQRRSVVISQPNKENLRHINAYNSLG
RKGTSYKSQSYTWSQSASSIVLNKLVDSINYPNEMGKKQLSSHRSSRCNSQQDLLLGTAV
PDQQGSDKCSDVTLQDSQKVLVVNKNLPSNAQIATQNYFSNFKEVEGDEDDYVEIKSEED
ESDLEAAQNHIQKSDPKIRDTDLSDDHHSNITSYSLSNPCASSTKPVNSKLGLSPYLTYG
DSDKLNEYLWSDSSPNQQNIVQALREKFQCLSSSSFA
Download sequence
Identical sequences F7GGB4
ENSMODP00000020937 ENSMODP00000020937 13616.ENSMODP00000020937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]