SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021333 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021333
Domain Number 1 Region: 262-376
Classification Level Classification E-value
Superfamily SEA domain 7.32e-20
Family SEA domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021333   Gene: ENSMODG00000017095   Transcript: ENSMODT00000021707
Sequence length 483
Comment pep:novel chromosome:BROADO5:2:189866081:189874363:-1 gene:ENSMODG00000017095 transcript:ENSMODT00000021707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPGIQPTVVLVLFLANLASLTLIAIIHSTSGTNNGLDSMMANYEKTSGNRNKNNMNLSI
RTPTVASSIFASTTHQSTTVTSDTYPSTTSTSTIHQSTTVTSSIPPTTPSTHTIYPSTIS
RPTSNHSTISTHTSHHSTLSRPTSNHSTISTPTNHHSTISRPTSNHSTISTPTSHHSTIS
RPTSNHSTISTPTSHHSTISRPTSNHSTISRPTITAPKHHPATTGNPKSISSTIHQIATS
GPNNNHSSISQSITISQSTSHHPAVVIAENSMFFLSFRILSKNFNSSLENPSSLYYQELK
NSLSDLLQQIYKNKAFMTFYLLQFRMGSVVTDCILVFQEGSITASEVQNLFAENLKKGYI
YNLNISSSDIIVRDWNSKTSSTGSSVPGYGIALLVIVCILLALAILHLAVMGLCQFRRKH
CGQLDIFPSQDSYHPMNEYPLYHTHGRYVPPGNTKRSPYEEISPGNGGNSLSYVNPVATS
ANL
Download sequence
Identical sequences F6V355
ENSMODP00000021333 ENSMODP00000021333 13616.ENSMODP00000021333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]