SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021558 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021558
Domain Number 1 Region: 272-364
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-25
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 438-539
Classification Level Classification E-value
Superfamily Immunoglobulin 9.93e-25
Family I set domains 0.0044
Further Details:      
 
Domain Number 3 Region: 1059-1153
Classification Level Classification E-value
Superfamily Immunoglobulin 2.62e-23
Family I set domains 0.0073
Further Details:      
 
Domain Number 4 Region: 935-1030
Classification Level Classification E-value
Superfamily Immunoglobulin 5.09e-23
Family I set domains 0.0017
Further Details:      
 
Domain Number 5 Region: 1159-1253
Classification Level Classification E-value
Superfamily Immunoglobulin 7.25e-22
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021558   Gene: ENSMODG00000017275   Transcript: ENSMODT00000021934
Sequence length 1309
Comment pep:novel chromosome:BROADO5:1:28678799:28774572:-1 gene:ENSMODG00000017275 transcript:ENSMODT00000021934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDDNIEASTSISQLLRESYLAETRHRGNIERSRAEATPNPFHFSSLAGAVGGGGGGGGQ
DDLPDLSAFLSQEELDESVNLARLAINQDTRESKADDSPTRKHLSSDQLKNSTKSSPETN
FYQYHPDSEANAKESTQETKKPPYSSETQSKKVFLNKAADFIEELSSLFKAHSSKRIRPR
SCKNHRSKLDPLNKAPQENCTSFSGLSERRERSSIPIPIPQDTQDNEVNHALEQQEAERL
QELELATNEITSSDATPDSSPSSLYYEEPLGQPPRFTQKLRSREVPEGTRVQLDCIVVGI
PPPQVRWYCEGKELENSPDVHIAQAGNLHTLTIAEAFEDDTGRYSCFASNIYGTDSTSAE
IYIEGASSSDSDGDISKEDMNRVQKPSETSSPPLNSAIIPQEAAEAQPSVVQPLLSTIQQ
CQSPTNYLQGLDGKPIIAAPVFTKMLQDLSASEGQLVVFECRVKGAPSPKVDWYREGTLI
EDSPDFRILQKKPRSMAEPEEICTLVIAEVFSEDSGNFTCTASNKYGTVSSIAQLTVRGA
EDHSNNVGHYTANSMGNSTVVENQSSPPNPEPRSMEQPPKPKLEGVLVNHNEPRSSSRIG
LRVHFNLPEDDNTSRTSAEDEAGIADQMPTDLLQDRFNGQIARTPEPSSPIKEPPPVLAK
PKLDSSQLQQLHNQVLMEQQQLQFLPSSSPKEFSFNPSTTNSPAAQMKAPRSQTFTYTRP
KQFFPSQSTSSPSGSPFSGSLQAIQRTASKENLLGSHSSGQTRSLGSFSSQNELPFPAES
PQSPPPTFSVSSGNQFQPRCVSPTTTVSPTGRIQNPVAFLSAVLPSLPAVPPTNAMGLPR
SAPSAPPQGLIKKNPKSPQSVVDDHIRENKAAVILDLEKKMHFSDVRLSQQEYKISSFEQ
RLMNEIEFRLERTPVDESDDEIQHDEIPTGKCIAPIFDKRLKHFRVTEGSPVKFTCKIVG
IPVPKVYWFKDGKQISKKNEHCKMKREEDGTCSLHIDSTTNDDDGNYTIMAANPQGRISC
SGHLMVQSLPLRGRFTSTHSHRGRARIPEGEKEPLQERFFRPHFLQAPGDMVAHEGRLCR
LDCKVSGLPPPELMWLLNGHPVLPDSTHKMLIRETGVHSLLIDPLTQKDAGTYTCIATNK
TGKNSFSLELTVVAKEIKKAPVFLEKLQNSGVPEGHPVRLECRVVGMPPPVFYWKKDNET
IPFTRERISMHQDTTGYVCLLIQPAKKSDAGWYTLSAKNEAGIVSCTARLDIYAQWHQQL
PQPMSVRPSGSRYGSLTSKGLDIFSAFSSMESTMVFSCSSQSMVESEEL
Download sequence
Identical sequences F6T3I5
XP_001369455.1.35504 XP_007478324.1.35504 ENSMODP00000021558 ENSMODP00000021558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]