SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021901 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021901
Domain Number 1 Region: 233-314
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.84e-29
Family PHD domain 0.00072
Further Details:      
 
Domain Number 2 Region: 411-664
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 5.75e-22
Family Hect, E3 ligase catalytic domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021901
Domain Number - Region: 160-222
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00512
Family PHD domain 0.014
Further Details:      
 
Domain Number - Region: 92-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0102
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021901   Gene: ENSMODG00000017557   Transcript: ENSMODT00000022285
Sequence length 693
Comment pep:novel chromosome:BROADO5:1:208892737:208971472:-1 gene:ENSMODG00000017557 transcript:ENSMODT00000022285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSCEDLPAASLDLISKELISMNENNLCQLQNFACVLCKRTDDHPEKYGEKKTYHDYN
LTVHYYCLLMSSGIWQRGEEKDGVYGFLIEDIRKEVNRASKLKCCICKKNGASIGCVSSK
CKRSYHFPCGVQKECIFQFTENFGSFCWDHRPVQNTPSGHCTVSSQCTICLEYVEHFPTY
SILGSPCCKNAWFHRDCLQVQALSAGKFFFKCPLCNNNDKFQSEMLRMGIHIPEKDASWE
LEENAYQELLQHYQRCDVRRCRCKEGREYNEPDSKWEIKRCQYCGSSGTHLACSSIRTWR
QNWECFECRSIIYNSGNFQRPKKRSLPNSENIGITNCLLEQPSPKFSRQSPRTQNKDSLR
SPKILHQGSLAPNSCLDKPPCSRRLTLISPLINVAAKNPSTKRQVTTLKRDVSNILRELG
YQIRQKTRKLSINKDNIWDSTIKGFRRRNFNPSDTIEVLFCNGNENINGSKHEFLSLLMG
HLESSSLFEGSMSKNLSFNSEALKENLYYEAGRMIAISLVHGGPPPFLFSKTLFNCLVYG
PENTEPTLEDVEDNNVIEIITKIKSSKNLTHLKSAVRDCFEYLSQIGCLRLVTMLSDKDM
LVKDILMSHVIKRVKAPLDSFQEGLKTLDVLEKMQKYPEAFYSILCHKPERLTTKILSDL
FTMHMLSEAQDTRAMGFWMSYLQDVENVSCNKK
Download sequence
Identical sequences F7BSS9
ENSMODP00000021901 ENSMODP00000021901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]