SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022197 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022197
Domain Number 1 Region: 410-561
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000652
Further Details:      
 
Domain Number 2 Region: 300-397
Classification Level Classification E-value
Superfamily LCCL domain 1.26e-24
Family LCCL domain 0.00072
Further Details:      
 
Domain Number 3 Region: 187-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-24
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022197   Gene: ENSMODG00000017807   Transcript: ENSMODT00000022586
Sequence length 858
Comment pep:novel chromosome:BROADO5:2:385737790:385846761:1 gene:ENSMODG00000017807 transcript:ENSMODT00000022586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPCRRRGQGEGGTPGAGWAEGRLQWERRGLPAPHLLRGNEKLVERGEVAGPLRGVCSG
VDKRLKWRGLGLNLSCRPAPNSRPKRRWGGRGRLSWRPELLAQAAGQGGKCGLPGKGEAP
RKLASSAGGAMIWGSNLDLAPWSVAGPPLLAPRLLPTLRSLLLLLLLLLLLPASAPLAGR
AEKLGDGCGHMVTYQDSGTLASKNYPGTYPNHTICERTITVPQGKRLILRLADVDIESQT
CESNYLLFVSSSAQHGPYCGSMTVPTEFYLDTNEVTVRFESASHISGRGFLLSYASSDHP
DLITCLDRANHFSKTEYSKFCPAGCRDIVGDISGNVVDGYRDTSLLCKAAVHAGVIADEL
GGQISVFQSKGISRYEGILANGVFSKDGSLSDKRFLFPFDGCSKSLSLKSSKQITASSSW
QWVNENGEVIHWSPGQAWLQDQGPSWASGDTGTNHKSEEWLEIDLGEKKKITGIRTAGST
QTNFNFYVKSFVMNFKNLNSKWKTYKGIVNNEEKIFQGNSNFRDPVRNNFIPPIVARYIR
IIPKTWHQRIALKVELIGCQITQGNNSFVWHKPSTSTGVSVGKEDKTLTKPIPSSEEERG
IKQRTIIIPLVLFMSLLVVGMVIFAAVKKKKMKGNPYGSAEAQKTGCWKLLKQPFVRRQS
SEFTISYENEKMTQKLDLVTSDMADYHQPLMIGTGTAMRKGSTFRPMDTEAETGKNSEPE
NHYACPHPTSRHEYALPLTNQEPEYATPIIERHLMREKAFPEGGYHVPAAAPAHKHSLSS
GGGFSNAAGADVQDYLAPQGLPLGEGDYDKPKGQSSLATEDHDSDYQKPQMNPFMKDGYS
APRDCLKPINQTAMTALL
Download sequence
Identical sequences F7CFE9
ENSMODP00000022197 ENSMODP00000022197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]