SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022371 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022371
Domain Number 1 Region: 263-398
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.09e-33
Family Canonical RBD 0.0000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022371   Gene: ENSMODG00000017937   Transcript: ENSMODT00000022761
Sequence length 673
Comment pep:novel chromosome:BROADO5:4:417856480:417870754:-1 gene:ENSMODG00000017937 transcript:ENSMODT00000022761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRDRFRSRGGGGGGFHRRGGGGGRGGGLSHDFRSPPPGMGLSQNRGPLGPGPVQTGPKP
SIPPPPAQQQQASSPDPPKPGLPPGSSPGPTVGTAAPASVSAPSAPPPGSGGPSGPGSAS
SQASSGPSAPPGAPQQSSSTPAVSSASSGGPPPPPPGAAGPKPGPSPGGPKGKMPGGPKP
GGPGLTPSGGHQKPPHRGGGEPRGGRQHHPPYHQQQPPPPPHHQGPSPGGPTGRSEEKIS
DSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITDEDFKRLFAKYGEPGEVFINKGKG
FGFIKLESRALAEIAKAELDDTPMRGRQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQ
FGPIERAVVIVDDRGRSTGKGIVEFASKPAARKAFERCSEGVFLLTTTPRPVIVEPLEQL
DDEDGLPEKLAQKNPMYQKERENPPRFAQHGTFEFEYSQRWKSLDEMEKQQREQVEKNMK
DAKDKLESEMEDAYHEHQANLLRQDLMRRQEELRRMEELHNQEMQKRKEIQLRQEEERRR
REEEMMIRQREMEEQMRRQREESYSRMGYMDPREREIRMGGAAAMNMGDPYGSGSQKFPP
LGGGGIGYEASPGVPPTALSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRG
REEYEGPNKKPRF
Download sequence
Identical sequences F7E3U7
ENSMODP00000022371 ENSMODP00000022371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]