SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022509 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022509
Domain Number 1 Region: 153-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-49
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 406-507
Classification Level Classification E-value
Superfamily PH domain-like 3.52e-19
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022509   Gene: ENSMODG00000018054   Transcript: ENSMODT00000022902
Sequence length 792
Comment pep:novel chromosome:BROADO5:8:107638540:107656506:1 gene:ENSMODG00000018054 transcript:ENSMODT00000022902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGYSTPDEGHLFHGLVASRIETYGGRHHRDPNNKAPWNLHLGKTTQQDTSHHRLQDLVA
FRYSGQSRGSSPLRLKDPESEKKHGGYFGSTPSSSPKLKEVAKARQLEMRLHTFSMFGMP
RLPPEDRRHWEIGEGGDNNLTIEKSWKELVPGHKEMSRGFCHQQEALWELLTTELLYIRK
LKIMTELLAAGLLNLQRVGLLTEVSAETLFGNVPNLIRAHQSFWEEVLEPTLKKTQISGQ
PLDPLGLQDGFLTFGQRFQPYIKYCVRVKQTMAYAREQQDNNPLFQIYVQWCEKHKRSGR
QQLSDLLIKPHQRITKYPLLLQAVLKRTPEPQVQDVLSAMISSVEAFLHHINSQVRQGEE
HDSLAAAAQRIGPYEVLEPSTEEVEKSLRPFSILDLTSPMLGVDHQHTRQLLLEGSVRMK
EGREGKDVYLFLFSDVILVTKPQRKADKAKVIRPPLMLEKLVCQALRDPNSFLMIHLTDF
QCVSSALVFHCSNPNECVHWLEKIQEAQVTLQKLKTEEYVHQKRELLALYRDIESPSTVP
PTPSPEGSQSSVEDHNLERSGTAEFPVLIPHLVVTEDREDSSLGMDDGSDSGYGTSSLPE
SQTPWIHRRRPALRQDPRLTLSTLDLRDIPRRLQPSNPHAPQRQSAPDLPEGDIIQEGHG
LPRRMPPNWSEKEEEEEGPSTGGNIVMETLHRAQLRGQLPFSPSQVDSAGESPWDSSGEE
EEESPLFVVPKRAEDMLQEIREDLASQRIDGISERVRESRNGQPRKLTIVELQRMRGPQI
IRLDTPLTTSEV
Download sequence
Identical sequences F7GEL9
ENSMODP00000022509 ENSMODP00000022509 XP_007503704.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]