SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022544 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022544
Domain Number 1 Region: 32-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000117
Family I set domains 0.036
Further Details:      
 
Domain Number 2 Region: 259-335
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000186
Family C1 set domains (antibody constant domain-like) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022544   Gene: ENSMODG00000018085   Transcript: ENSMODT00000022938
Sequence length 578
Comment pep:novel chromosome:BROADO5:4:72422675:72564821:1 gene:ENSMODG00000018085 transcript:ENSMODT00000022938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKGWTYGMIYSVIQIHLVWGLVKATSDGKNVIYASPGTDVKLMCEVQKTSSLVQTQWSK
LTNSTEMIALYHPQHGYHCNARTACTSLVTFTKISPNVSEWILHLRNVSAAANGKYECSF
TLFPDGIWTKVLNLLIQTEVAQEERGGNYTAEVLFNHTLEIPCFRNISSVASSGITFAWL
MVSIILFSGKILYSQQEENGMQETRIIQNNTFPDNRIILRKDHALYLSPIEILDNNRKFS
CHVTIHSGKILKNVTRITVFAKPEISMDMQNSSTDILEEKNFSCLVRNVFPTANLSWYID
GELLQDQKEGIDMTTEKRNRDEGFYELTSMLRVLKPNQSIVPNNLTVWCMTLFPVPGNEV
WNISSRKITFSFGYVNTPTDSSNFTESTFSAFTSSLSSTGTAAGKKTSTSIFSKNTSIVE
PEFEPRSSNSSANIFPTSSNFALSSNSVFHLPSETGKKTATIPGMCSHLGIRVSPLRTSS
ELPAGTTTANLFTENDYSHVTSTLPNKSEGGMSWPVIVASLLFICFFLFGLGVRKWCQYL
KEIMERPPPFKPPPPPIKYTCIGEAVGDDLPCHEMETL
Download sequence
Identical sequences F7FTH8
ENSMODP00000022544 ENSMODP00000022544 13616.ENSMODP00000022544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]